DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment iotaTry and PRSS3

DIOPT Version :9

Sequence 1:NP_523695.1 Gene:iotaTry / 36223 FlyBaseID:FBgn0015001 Length:252 Species:Drosophila melanogaster
Sequence 2:XP_011516267.1 Gene:PRSS3 / 5646 HGNCID:9486 Length:333 Species:Homo sapiens


Alignment Length:250 Identity:83/250 - (33%)
Similarity:126/250 - (50%) Gaps:28/250 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LGDASDVEATGRIIGGSDQLIRNAPWQVSIQISARHECGGVIYSKEIIITAGHCLHERSVTLMKV 80
            ||.|...:...:|:||......:.|:|||:. |..|.|||.:.|::.:::|.||...|    ::|
Human    98 LGVAVPFDDDDKIVGGYTCEENSLPYQVSLN-SGSHFCGGSLISEQWVVSAAHCYKTR----IQV 157

  Fly    81 RVGAQNHN---YGGTLVPVAAYKV--HEQFDSRFLHYDIAVLRLSTPLTFGLSTRAINLASTSPS 140
            |:|  .||   ..|....:.|.|:  |.:::...|..||.:::||:|.........|:|.:|.|:
Human   158 RLG--EHNIKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTTPPA 220

  Fly   141 GGTTVTVTGWGHT-DNGA-LSDSLQKAQLQIIDRGECASQKFGYGADFVGEET---ICAASTDA- 199
            .||...::|||:| ..|| ..|.|:.....::.:.||.       |.:.|:.|   .|....:. 
Human   221 AGTECLISGWGNTLSFGADYPDELKCLDAPVLTQAECK-------ASYPGKITNSMFCVGFLEGG 278

  Fly   200 -DACTGDSGGPLVASSQLVGIVSWGYRCADDNYPGVYADVAILRPWI--VKAANA 251
             |:|..|||||:|.:.||.|:||||:.||..|.||||..|.....||  ..|||:
Human   279 KDSCQRDSGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDTIAANS 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iotaTryNP_523695.1 Tryp_SPc 27..245 CDD:214473 75/229 (33%)
Tryp_SPc 28..247 CDD:238113 77/232 (33%)
PRSS3XP_011516267.1 Tryp_SPc 109..325 CDD:214473 75/229 (33%)
Tryp_SPc 110..328 CDD:238113 77/231 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.