DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment iotaTry and PRSS2

DIOPT Version :9

Sequence 1:NP_523695.1 Gene:iotaTry / 36223 FlyBaseID:FBgn0015001 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001290343.1 Gene:PRSS2 / 5645 HGNCID:9483 Length:261 Species:Homo sapiens


Alignment Length:267 Identity:91/267 - (34%)
Similarity:136/267 - (50%) Gaps:34/267 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LVLLLLGDASDVEA----TGRIIGGSDQLIRNAPWQVSIQISARHECGGVIYSKEIIITAGHC-- 69
            |:|:|...|:.|.|    ..:|:||......:.|:|||:. |..|.|||.:.|::.:::||||  
Human     3 LLLILTFVAAAVAAPFDDDDKIVGGYICEENSVPYQVSLN-SGYHFCGGSLISEQWVVSAGHCYK 66

  Fly    70 ------LHERSVTLMKVRVGAQNHN---YGGTLVPVAAYKV--HEQFDSRFLHYDIAVLRLSTPL 123
                  |..|.....:::|....||   ..|....:.|.|:  |.:::||.|..||.:::||:|.
Human    67 SAINSKLSGRGCEYHRIQVRLGEHNIEVLEGNEQFINAAKIIRHPKYNSRTLDNDILLIKLSSPA 131

  Fly   124 TFGLSTRAINLASTSPSGGTTVTVTGWGHT-DNGA-LSDSLQKAQLQIIDRGECASQKFGYGADF 186
            .......||:|.:..|:.||...::|||:| .:|| ..|.||.....::.:.||.       |.:
Human   132 VINSRVSAISLPTAPPAAGTESLISGWGNTLSSGADYPDELQCLDAPVLSQAECE-------ASY 189

  Fly   187 VGEET---ICAASTDA--DACTGDSGGPLVASSQLVGIVSWGYRCADDNYPGVYADVAILRPWI- 245
            .|:.|   .|....:.  |:|.||||||:|::.:|.|||||||.||..|.||||..|.....|| 
Human   190 PGKITNNMFCVGFLEGGKDSCQGDSGGPVVSNGELQGIVSWGYGCAQKNRPGVYTKVYNYVDWIK 254

  Fly   246 -VKAANA 251
             ..|||:
Human   255 DTIAANS 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iotaTryNP_523695.1 Tryp_SPc 27..245 CDD:214473 80/237 (34%)
Tryp_SPc 28..247 CDD:238113 82/240 (34%)
PRSS2NP_001290343.1 Tryp_SPc 23..253 CDD:214473 80/237 (34%)
Tryp_SPc 24..256 CDD:238113 82/239 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.