DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment iotaTry and KLK15

DIOPT Version :9

Sequence 1:NP_523695.1 Gene:iotaTry / 36223 FlyBaseID:FBgn0015001 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_059979.2 Gene:KLK15 / 55554 HGNCID:20453 Length:256 Species:Homo sapiens


Alignment Length:269 Identity:78/269 - (28%)
Similarity:114/269 - (42%) Gaps:51/269 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IVATVLVLLLLGDASDVEATGRIIGGSDQLIRNAPWQVSIQISARHECGGVIYSKEIIITAGHCL 70
            ::.|:..||....|.|.:   :::.|.:....:.||||::....|..||..:.|...:::|.|| 
Human     3 LLLTLSFLLASTAAQDGD---KLLEGDECAPHSQPWQVALYERGRFNCGASLISPHWVLSAAHC- 63

  Fly    71 HERSVTLMKVRVGAQNHNY-----------GGTLVPVAAYKVHEQFDSRFLHYDIAVLRLSTPLT 124
               ....|:||:|  .||.           ...::|      |.::::|....||.:|||..|..
Human    64 ---QSRFMRVRLG--EHNLRKRDGPEQLRTTSRVIP------HPRYEARSHRNDIMLLRLVQPAR 117

  Fly   125 FGLSTRAINLASTSPSGGTTVTVTGWG---HTDNG---------ALSDSLQKAQLQIIDRGECAS 177
            .....|...|.:..|..|....|:|||   |.:.|         :|.|:|..|.:.||....|  
Human   118 LNPQVRPAVLPTRCPHPGEACVVSGWGLVSHNEPGTAGSPRSQVSLPDTLHCANISIISDTSC-- 180

  Fly   178 QKFGYGADFVGEET---ICAAS--TDADACTGDSGGPLVASSQLVGIVSWG-YRCADDNYPGVYA 236
                 ...:.|..|   :||.:  ..|::|.||||||||....|.|||||| ..|.:...||||.
Human   181 -----DKSYPGRLTNTMVCAGAEGRGAESCEGDSGGPLVCGGILQGIVSWGDVPCDNTTKPGVYT 240

  Fly   237 DVAILRPWI 245
            .|.....||
Human   241 KVCHYLEWI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iotaTryNP_523695.1 Tryp_SPc 27..245 CDD:214473 71/246 (29%)
Tryp_SPc 28..247 CDD:238113 73/247 (30%)
KLK15NP_059979.2 Tryp_SPc 25..249 CDD:214473 71/242 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.