DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment iotaTry and ctrb.3

DIOPT Version :9

Sequence 1:NP_523695.1 Gene:iotaTry / 36223 FlyBaseID:FBgn0015001 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001017724.1 Gene:ctrb.3 / 550419 ZFINID:ZDB-GENE-050417-229 Length:265 Species:Danio rerio


Alignment Length:266 Identity:89/266 - (33%)
Similarity:131/266 - (49%) Gaps:32/266 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AVYGIVATVLVLLLLGDASDVEATGRIIGGSDQLIRNAPWQVSIQ-ISARHECGGVIYSKEIIIT 65
            |.||.....:..::.|.|       ||:.|.:.:..:.|||||:| .:..|.|||.:.::..::|
Zfish    15 AAYGCGVPAIPPVVSGYA-------RIVNGEEAVPHSWPWQVSLQDFTGFHFCGGSLINEFWVVT 72

  Fly    66 AGHCLHERSV-TLMKVRVGAQNHNYGGTLVPVAAYKV-----HEQFDSRFLHYDIAVLRLSTPLT 124
            |.||    || |..:|.:|..|.....|...:...||     |.|::|..:..|||:::|:.|.:
Zfish    73 AAHC----SVRTSHRVILGEHNKGKSNTQEDIQTMKVSKVFTHPQYNSNTIENDIALVKLTAPAS 133

  Fly   125 FGLSTRAINLASTSP--SGGTTVTVTGWGHTDNGAL--SDSLQKAQLQIIDRGECASQKFGYGAD 185
            .......:.||..|.  :.|.|...:|||.|...||  .|.||:..|.::...:|   |..:|::
Zfish   134 LNAHVSPVCLAEASDNFASGMTCVTSGWGVTRYNALFTPDELQQVALPLLSNEDC---KNHWGSN 195

  Fly   186 FVGEETICAASTDADACTGDSGGPLVASSQ----LVGIVSWGYRCADDNYPGVYADVAILRPWI- 245
             :.:..|||.:..|.:|.||||||||....    ||||||||....|...||||..|..||.|: 
Zfish   196 -IRDTMICAGAAGASSCMGDSGGPLVCQKDNIWTLVGIVSWGSSRCDPTMPGVYGRVTELRDWVD 259

  Fly   246 -VKAAN 250
             :.|:|
Zfish   260 QILASN 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iotaTryNP_523695.1 Tryp_SPc 27..245 CDD:214473 81/232 (35%)
Tryp_SPc 28..247 CDD:238113 81/235 (34%)
ctrb.3NP_001017724.1 Tryp_SPc 33..258 CDD:214473 81/232 (35%)
Tryp_SPc 34..261 CDD:238113 81/234 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 162 1.000 Inparanoid score I4193
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.