DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment iotaTry and prss1

DIOPT Version :9

Sequence 1:NP_523695.1 Gene:iotaTry / 36223 FlyBaseID:FBgn0015001 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001015792.1 Gene:prss1 / 548509 XenbaseID:XB-GENE-5776262 Length:244 Species:Xenopus tropicalis


Alignment Length:255 Identity:91/255 - (35%)
Similarity:133/255 - (52%) Gaps:28/255 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VLVLLLLGDASDVEATGRIIGGSDQLIRNAPWQVSIQISARHECGGVIYSKEIIITAGHCLHERS 74
            ::||:|||.|...|...:|:||........|:|||:. :..|.|||.:.:.:.:::|.||...| 
 Frog     4 LIVLVLLGAAVAFEDDDKIVGGFTCTKNAVPYQVSLN-AGYHFCGGSLINSQWVVSAAHCYKSR- 66

  Fly    75 VTLMKVRVGAQNHNYG---GTLVPVAAYKV--HEQFDSRFLHYDIAVLRLSTPLTFGLSTRAINL 134
               ::||:|  .||..   ||...:.:.||  |..::||.|..||.:::|||......:.:::.|
 Frog    67 ---IQVRLG--EHNIAVNEGTEQFIESQKVIKHPSYNSRNLDNDIMLIKLSTTARLSSNIQSVPL 126

  Fly   135 ASTSPSGGTTVTVTGWGHTDNGALS--DSLQKAQLQIIDRGECASQKFGYGADFVGEET---ICA 194
            .|...|.||...::|||:|.:...:  |.||.....|:...||::       .:.||.|   .||
 Frog   127 PSACASAGTNCLISGWGNTLSSGTNYPDLLQCLNAPILTASECSN-------SYPGEITNNMFCA 184

  Fly   195 A--STDADACTGDSGGPLVASSQLVGIVSWGYRCADDNYPGVYADVAILRPWIVK--AAN 250
            .  :...|:|.||||||:|.:.||.|:|||||.||..||||||..|.....||..  |||
 Frog   185 GFLAGGKDSCQGDSGGPVVCNGQLQGVVSWGYGCAQRNYPGVYTKVCNYVSWIQNTIAAN 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iotaTryNP_523695.1 Tryp_SPc 27..245 CDD:214473 79/229 (34%)
Tryp_SPc 28..247 CDD:238113 81/230 (35%)
prss1NP_001015792.1 Tryp_SPc 22..240 CDD:238113 81/231 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.