DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment iotaTry and Elane

DIOPT Version :9

Sequence 1:NP_523695.1 Gene:iotaTry / 36223 FlyBaseID:FBgn0015001 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_056594.2 Gene:Elane / 50701 MGIID:2679229 Length:265 Species:Mus musculus


Alignment Length:249 Identity:63/249 - (25%)
Similarity:104/249 - (41%) Gaps:27/249 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VATVLVLLLLGDASDVEATGRIIGGSDQLIRNAPWQVSIQISARHECGGVIYSKEIIITAGHCLH 71
            :|.:|:.|.||..:   ....|:||........|:..|:|....|.||..:.::..:::|.||::
Mouse    11 LAAMLLALFLGGPA---LASEIVGGRPARPHAWPFMASLQRRGGHFCGATLIARNFVMSAAHCVN 72

  Fly    72 ERSVTLMKVRVGAQN-HNYGGTLVPVAAYKVHEQ-FDSRFLHYDIAVLRLSTPLTFGLSTRAINL 134
            ..:...::|.:||.: .....|....:..::.|. ||...|..||.:::|:...|...:.:...|
Mouse    73 GLNFRSVQVVLGAHDLRRQERTRQTFSVQRIFENGFDPSQLLNDIVIIQLNGSATINANVQVAQL 137

  Fly   135 ASTSPSGG--TTVTVTGWGHTDNGALSDS-LQKAQLQIIDRGECASQKFGYGADFVGEETIC--A 194
            .:.....|  |.....|||.......|.| ||:..:.:: ...|..:           ..:|  .
Mouse   138 PAQGQGVGDRTPCLAMGWGRLGTNRPSPSVLQELNVTVV-TNMCRRR-----------VNVCTLV 190

  Fly   195 ASTDADACTGDSGGPLVASSQLVGIVSW---GYRCADDNYPGVYADVAILRPWI 245
            ....|..|.||||||||.::.:.||.|:   |  |....||..:|.||....||
Mouse   191 PRRQAGICFGDSGGPLVCNNLVQGIDSFIRGG--CGSGLYPDAFAPVAEFADWI 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iotaTryNP_523695.1 Tryp_SPc 27..245 CDD:214473 56/227 (25%)
Tryp_SPc 28..247 CDD:238113 58/228 (25%)
ElaneNP_056594.2 Tryp_SPc 28..242 CDD:214473 56/227 (25%)
Tryp_SPc 29..245 CDD:238113 58/228 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.