DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment iotaTry and Prss53

DIOPT Version :9

Sequence 1:NP_523695.1 Gene:iotaTry / 36223 FlyBaseID:FBgn0015001 Length:252 Species:Drosophila melanogaster
Sequence 2:XP_006230384.1 Gene:Prss53 / 499270 RGDID:1566127 Length:591 Species:Rattus norvegicus


Alignment Length:260 Identity:63/260 - (24%)
Similarity:97/260 - (37%) Gaps:56/260 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LGDASDVEATGRIIGGSDQ--LIRNAPWQVSIQISARHECGGVIYSKEIIITAGHC------LHE 72
            :.|.:...|.|.:..|..|  .:...||...::...:..|||.:.|:.:::||.||      |.|
  Rat   326 MSDENSCVACGSLSSGGPQAGALSQWPWDARLKHHGKLACGGALVSEVVVLTAAHCFIGRQTLEE 390

  Fly    73 RSVTL--------MKVRV--GAQNHNYGGTLVPVAAYKVHEQFDSRFLHYDIAVLRLSTPLTFGL 127
            .||.|        :|..:  ||..|..||                    :|:|.|.|:.|:|.|.
  Rat   391 WSVGLGAGPEEWGLKQLILHGAYTHPEGG--------------------HDVAFLLLAQPVTLGP 435

  Fly   128 STRAINLASTS---PSGGTTVTVTGW--GHTDNGALSDSLQKAQLQIIDRGECASQKFGYGADFV 187
            ..|.:.|....   |.|     ..||  |.|....::.. ....:.::....|:.|....|:..|
  Rat   436 GLRPLCLPYADHRLPDG-----EHGWVLGLTREAGINHP-HTVPVTVLGPMACSRQHAASGSTGV 494

  Fly   188 G--EETICAAST-DADACTGDSGGPLVASSQ----LVGIVSWGYRCADDNYPGVYADVAILRPWI 245
            .  ...||.... :...|.|.||.|||...:    |.|:.|:|..|.....|.|:|.::....|:
  Rat   495 PILPGMICTTVVGEPPHCEGLSGAPLVHEIRGTWFLAGLHSFGDTCQGSAKPAVFAALSAYEDWV 559

  Fly   246  245
              Rat   560  559

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iotaTryNP_523695.1 Tryp_SPc 27..245 CDD:214473 59/247 (24%)
Tryp_SPc 28..247 CDD:238113 60/248 (24%)
Prss53XP_006230384.1 Tryp_SPc 45..310 CDD:238113
Tryp_SPc 341..561 CDD:238113 60/245 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343322
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.