DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment iotaTry and KLK12

DIOPT Version :9

Sequence 1:NP_523695.1 Gene:iotaTry / 36223 FlyBaseID:FBgn0015001 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_062544.1 Gene:KLK12 / 43849 HGNCID:6360 Length:254 Species:Homo sapiens


Alignment Length:242 Identity:75/242 - (30%)
Similarity:108/242 - (44%) Gaps:34/242 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LVLLLLGDASDVEATGRIIGGSDQLIRNAPWQVSIQISARHECGGVIYSKEIIITAGHC------ 69
            |:|.:||.:.  .||.:|..|::....:.||||.:.......||||:.....::||.||      
Human     7 LLLCVLGLSQ--AATPKIFNGTECGRNSQPWQVGLFEGTSLRCGGVLIDHRWVLTAAHCSGSRYW 69

  Fly    70 --LHERSVTLM----KVRVGAQNHNYGGTLVPVAAYKVHEQFDSRFLHYDIAVLRLSTPLTFGLS 128
              |.|.|::.:    ::|....:..:.|.|   .|...||        :|:.:|||..|:....|
Human    70 VRLGEHSLSQLDWTEQIRHSGFSVTHPGYL---GASTSHE--------HDLRLLRLRLPVRVTSS 123

  Fly   129 TRAINLASTSPSGGTTVTVTGWGHTDN--GALSDSLQKAQLQIIDRGECASQKFGYGADFVGEET 191
            .:.:.|.:...:.||...|:|||.|::  ....|.||...|.|:....|    .|.....:....
Human   124 VQPLPLPNDCATAGTECHVSGWGITNHPRNPFPDLLQCLNLSIVSHATC----HGVYPGRITSNM 184

  Fly   192 ICAASTDA-DACTGDSGGPLVASSQLVGIVSWGY--RCADDNYPGVY 235
            :||..... |||.||||||||....|.|:||||.  .|..|..||||
Human   185 VCAGGVPGQDACQGDSGGPLVCGGVLQGLVSWGSVGPCGQDGIPGVY 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iotaTryNP_523695.1 Tryp_SPc 27..245 CDD:214473 69/226 (31%)
Tryp_SPc 28..247 CDD:238113 69/225 (31%)
KLK12NP_062544.1 Tryp_SPc 21..236 CDD:214473 69/226 (31%)
Tryp_SPc 22..236 CDD:238113 69/225 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.