DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment iotaTry and CG34130

DIOPT Version :9

Sequence 1:NP_523695.1 Gene:iotaTry / 36223 FlyBaseID:FBgn0015001 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001036759.1 Gene:CG34130 / 4379866 FlyBaseID:FBgn0083966 Length:297 Species:Drosophila melanogaster


Alignment Length:220 Identity:53/220 - (24%)
Similarity:98/220 - (44%) Gaps:20/220 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 PWQVSIQISARHECGGVIYSKEIIITAGHCLHE-----RSVTLMKVRVGAQNHNYGGTLVPVAAY 99
            ||.:.|.......||....|....:|:.:|:|.     .|:::..|...::..|...:..|..|.
  Fly    56 PWLLRIVDGPTFVCGASYLSALYALTSANCMHSHRSQMESLSVELVSSDSRQDNQLDSHDPPNAL 120

  Fly   100 KVHEQFDSRFLHY-----DIAVLRLSTPLTFGLSTRAINLASTSPSGGTTVTVTGWGHTDNGALS 159
             :.....|:..|:     |:||:.|:..|. |.....:.|.:...|...:::|..:|    ...:
  Fly   121 -IRNIIVSKDWHWPGTFMDVAVIELTNRLR-GNRNNYVTLCTNPLSSYKSLSVVSYG----AGPA 179

  Fly   160 DSLQKAQLQIIDRGECASQKFGYGADFVGEETICAASTDADA-CTGDSGGPLVASSQLVGIVSWG 223
            ::::..::::::|..|.|   .||...:.|...||......| |...:|.|:.|..||.|||:|.
  Fly   180 ENVRTEEIEVLNRMICDS---AYGNFLLRETVACAKEFKRSADCMFSAGCPVTAGDQLCGIVAWS 241

  Fly   224 YRCADDNYPGVYADVAILRPWIVKA 248
            ..|...|.||::.|:..::.:|:||
  Fly   242 PACKRSNLPGIFTDIHQVKRFILKA 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iotaTryNP_523695.1 Tryp_SPc 27..245 CDD:214473 50/215 (23%)
Tryp_SPc 28..247 CDD:238113 51/217 (24%)
CG34130NP_001036759.1 Trypsin 53..263 CDD:278516 50/215 (23%)
Tryp_SPc 53..256 CDD:304450 49/208 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.