DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment iotaTry and CG5255

DIOPT Version :9

Sequence 1:NP_523695.1 Gene:iotaTry / 36223 FlyBaseID:FBgn0015001 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster


Alignment Length:250 Identity:75/250 - (30%)
Similarity:114/250 - (45%) Gaps:13/250 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IVATVLVLLLLGDASDV-----EATGRIIGGSDQLIRNAPWQVSIQ--ISARHECGGVIYSKEII 63
            ::...|||.....||.:     ....||:||.:.....||:|:|:|  .|..|.|||.|..:..|
  Fly     3 LILLPLVLFTSSAASQILYPPQYTKNRIVGGEEAAAGLAPYQISLQGIGSGAHSCGGAIIDERWI 67

  Fly    64 ITAGHCLHERSVTLMKVRVGAQN-HNYGGTLVPVAAYKVHEQFDSRFLHYDIAVLRLSTPLTFGL 127
            |||.||...|..|..:|..|.|: |..|...........|..:..|....|||:|.|:..:.|..
  Fly    68 ITAAHCTRGRQATAFRVLTGTQDLHQNGSKYYYPDRIVEHSNYAPRKYRNDIALLHLNESIVFDN 132

  Fly   128 STRAINLASTSPSGGTTVTVTGWGHTD-NGALSDSLQKAQLQIIDRGECASQKFGYGADFVGEET 191
            :|:.:.|...:...|:.:.:||||... .|.:...||..::..:...:|.:.........:|.  
  Fly   133 ATQPVELDHEALVPGSRLLLTGWGTLSLGGDVPARLQSLEVNYVPFEQCRAAHDNSTRVDIGH-- 195

  Fly   192 ICAASTDA-DACTGDSGGPLVASSQLVGIVSWGYRCADDNYPGVYADVAILRPWI 245
            :|..:... .||.||||||||.:.:||.:|:||..|| ..||..:|.::....:|
  Fly   196 VCTFNDKGRGACHGDSGGPLVHNGKLVALVNWGLPCA-KGYPDAHASISYYHDFI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iotaTryNP_523695.1 Tryp_SPc 27..245 CDD:214473 69/222 (31%)
Tryp_SPc 28..247 CDD:238113 68/222 (31%)
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 69/222 (31%)
Tryp_SPc 30..252 CDD:238113 68/222 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.