DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment iotaTry and CG12951

DIOPT Version :9

Sequence 1:NP_523695.1 Gene:iotaTry / 36223 FlyBaseID:FBgn0015001 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster


Alignment Length:256 Identity:81/256 - (31%)
Similarity:121/256 - (47%) Gaps:32/256 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VLVLLLLGDASDVEATGRIIGGSDQLIRNAPWQVSIQ-ISARHECGGVIYSKEIIITAGHCLHER 73
            :|.:..:|.|:  .:..|::.|:|..:...|:.||:: ....|.|||.|.||..::||.||.:.|
  Fly    14 ILAVTTVGQAA--PSISRVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIISKHFVMTAAHCTNGR 76

  Fly    74 SVTLMKVRVGAQNHN-YGGTLVPVAAYKVHEQFD-SRFLHYDIAVLRLSTPLTF-GLSTRAINL- 134
            ....:.::.|..|.: .|..:|.:.....||.|| :|....||::|.:..|..| |:|...:.| 
  Fly    77 PADTLSIQFGVTNISAMGPNVVGIKKIIQHEDFDPTRQNANDISLLMVEEPFEFDGVSVAPVELP 141

  Fly   135 ----ASTSPSGGTTVTVTGWGHTDN-GALSDSLQKAQLQIIDRGECASQKFGY---------GAD 185
                |......|....:.|||..|. |::.|:||:..|:|....||.|:..|.         |.|
  Fly   142 ALAFAVPQSDAGVEGVLIGWGLNDTYGSVQDTLQEVSLKIYSDEECTSRHNGQTDPKYHICGGVD 206

  Fly   186 FVGEETICAASTDADACTGDSGGPLVASSQLVGIVSWGYR-CADDNYPGVYADVAILRPWI 245
            ..|:          ..|:|||||||:.:.|.||||||..: |....|||||..|:....||
  Fly   207 EGGK----------GQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iotaTryNP_523695.1 Tryp_SPc 27..245 CDD:214473 76/237 (32%)
Tryp_SPc 28..247 CDD:238113 77/238 (32%)
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 76/237 (32%)
Tryp_SPc 30..260 CDD:238113 77/238 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
33.010

Return to query results.
Submit another query.