DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment iotaTry and Try10

DIOPT Version :9

Sequence 1:NP_523695.1 Gene:iotaTry / 36223 FlyBaseID:FBgn0015001 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001004097.1 Gene:Try10 / 408247 RGDID:1359400 Length:246 Species:Rattus norvegicus


Alignment Length:255 Identity:86/255 - (33%)
Similarity:132/255 - (51%) Gaps:26/255 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VLVLLLLGDASDVEAT--GRIIGGSDQLIRNAPWQVSIQISARHECGGVIYSKEIIITAGHCLHE 72
            ||:|.|:|.|....|.  .:|:||......:.|:|||:. |..|.|||.:.:::.:::|.||...
  Rat     4 VLILALVGAAVAFPAADDDKIVGGYTCQENSVPYQVSLN-SGYHFCGGSLINEQWVVSAAHCYKS 67

  Fly    73 RSVTLMKVRVGAQNHN-YGGTLVPVAAYKV--HEQFDSRFLHYDIAVLRLSTPLTFGLSTRAINL 134
            |    ::||:|..|.| ..|....|.|.|:  |..|..:.|:.||.:::||:|:........:.|
  Rat    68 R----IQVRLGEHNINVLEGNEQFVNAAKIIKHPNFIRKTLNNDIMLIKLSSPVKLNSRVATVAL 128

  Fly   135 ASTSPSGGTTVTVTGWGHTDNGALS--DSLQKAQLQIIDRGECASQKFGYGADFVGEET---ICA 194
            .|:....||...::|||:|.:..::  |.||.....::.:.:|.       |.:.|:.|   :||
  Rat   129 PSSCAPAGTQCLISGWGNTLSFGVNEPDLLQCLDAPLLPQADCE-------ASYPGKITDNMVCA 186

  Fly   195 ASTDA--DACTGDSGGPLVASSQLVGIVSWGYRCADDNYPGVYADVAILRPWI--VKAAN 250
            ...:.  |:|.||||||:|.:.:|.|||||||.||..:.||||..|.....||  ..|||
  Rat   187 GFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iotaTryNP_523695.1 Tryp_SPc 27..245 CDD:214473 74/227 (33%)
Tryp_SPc 28..247 CDD:238113 76/230 (33%)
Try10NP_001004097.1 Tryp_SPc 23..239 CDD:214473 74/227 (33%)
Tryp_SPc 24..242 CDD:238113 76/229 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 152 1.000 Inparanoid score I4263
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.