DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment iotaTry and Tmprss11c

DIOPT Version :9

Sequence 1:NP_523695.1 Gene:iotaTry / 36223 FlyBaseID:FBgn0015001 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001003979.1 Gene:Tmprss11c / 408213 RGDID:1302967 Length:418 Species:Rattus norvegicus


Alignment Length:258 Identity:90/258 - (34%)
Similarity:122/258 - (47%) Gaps:35/258 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LLGDASDVEATG-----------RIIGGSDQLIRNAPWQVSIQISARHECGGVIYSKEIIITAGH 68
            ||.|:|..:.:|           ::.||.|......|||.|:|.:..|.||..:.|...:|||.|
  Rat   163 LLIDSSSFKFSGCGRRTITPGGHKVAGGQDAEEGEWPWQASLQQNNVHRCGATLISNSWLITAAH 227

  Fly    69 CLHERSVTLMKVRVGAQNHNYGGTLVPVAAYK------VHEQFDSRFLHYDIAVLRLSTPLTFGL 127
            |. .||......:|     ::|..|....|.:      :||.:.....:.||||:|||:|:.:..
  Rat   228 CF-VRSANPKDWKV-----SFGFLLSKPQAQRAVKSIVIHENYSYPAHNNDIAVVRLSSPVLYEN 286

  Fly   128 STRAINL--ASTSPSGGTTVTVTGWGH-TDNGALSDSLQKAQLQIIDRGECASQKFGYGADFVGE 189
            :.|...|  |:......:.|.|||||. ..:|...:.|||.:::|||...|.|.| .||. .:..
  Rat   287 NIRRACLPEATQKFPPNSDVVVTGWGTLKSDGDSPNILQKGRVKIIDNKTCNSGK-AYGG-VITP 349

  Fly   190 ETICAASTD--ADACTGDSGGPLVASSQ-----LVGIVSWGYRCADDNYPGVYADVAILRPWI 245
            ..:||...:  .|||.||||||||:...     |.||||||..||..|.||||..|...|.||
  Rat   350 GMLCAGFLEGRVDACQGDSGGPLVSEDSKGIWFLAGIVSWGDECALPNKPGVYTRVTHYRDWI 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iotaTryNP_523695.1 Tryp_SPc 27..245 CDD:214473 83/233 (36%)
Tryp_SPc 28..247 CDD:238113 85/234 (36%)
Tmprss11cNP_001003979.1 SEA 62..157 CDD:279699
Tryp_SPc 186..412 CDD:214473 83/233 (36%)
Tryp_SPc 187..415 CDD:238113 85/234 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.