DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment iotaTry and Klk4

DIOPT Version :9

Sequence 1:NP_523695.1 Gene:iotaTry / 36223 FlyBaseID:FBgn0015001 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001004101.1 Gene:Klk4 / 408210 RGDID:1303228 Length:256 Species:Rattus norvegicus


Alignment Length:246 Identity:72/246 - (29%)
Similarity:111/246 - (45%) Gaps:23/246 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LVLLLLGDASDVEATGRIIGGSDQLIRNAPWQVSIQISARHE--CGGVIYSKEIIITAGHCLHER 73
            |:|.:.|.::. ..:.|||.|.|.|..:.|||.:: .|..:.  |.||:...:.:::|.||:.: 
  Rat    16 LILEVTGSSAS-SISSRIIQGQDCLPHSQPWQAAL-FSEDNAFFCSGVLVHPQWVLSAAHCIQD- 77

  Fly    74 SVTLMKVRVGAQNHNYGGTLVP----VAAYK--VHEQFDSRFLHYDIAVLRLSTPLTFGLSTRAI 132
            |.|     ||...||..|:..|    :.|:.  .|..::......|:.:::|:..:....:.|.|
  Rat    78 SYT-----VGLGLHNLEGSQEPGSRMLEAHLSIQHPNYNDPSFANDLMLIKLNESVMESNTIRRI 137

  Fly   133 NLASTSPSGGTTVTVTGWGHTDNGALSDSLQKAQLQIIDRGECASQKFGYGADFVGEETICAAS- 196
            .:||..|:.|.|..|:|||...||.|...||...|.:.....|   :..|...: .....||.. 
  Rat   138 PVASQCPTPGDTCLVSGWGRLKNGKLPSLLQCVNLSVASEETC---RLLYDPVY-HLSMFCAGGG 198

  Fly   197 -TDADACTGDSGGPLVASSQLVGIVSWGY-RCADDNYPGVYADVAILRPWI 245
             ...|.|.||||||:|.:..|.|:||.|. .|.....|.||.::.....||
  Rat   199 PDRKDTCNGDSGGPIVCNRSLQGLVSMGQGECGQPGIPSVYTNLCKFTNWI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iotaTryNP_523695.1 Tryp_SPc 27..245 CDD:214473 67/228 (29%)
Tryp_SPc 28..247 CDD:238113 68/229 (30%)
Klk4NP_001004101.1 Tryp_SPc 35..249 CDD:238113 64/224 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 148 1.000 Domainoid score I4330
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.