DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment iotaTry and CG32269

DIOPT Version :9

Sequence 1:NP_523695.1 Gene:iotaTry / 36223 FlyBaseID:FBgn0015001 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001261363.1 Gene:CG32269 / 3772569 FlyBaseID:FBgn0052269 Length:332 Species:Drosophila melanogaster


Alignment Length:234 Identity:76/234 - (32%)
Similarity:126/234 - (53%) Gaps:17/234 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 ASDVEATGRIIGGSDQLIRNAPWQVSIQISARHECGGVIYSKEIIITAGHCLHERSVTLMKVRVG 83
            |:..:...||:||:...|...|:.|.:: ...:.|.|.:.:::.::||.||:...|.:...||.|
  Fly   100 ATSSKIQSRIVGGTSTTISTTPYIVQLR-RGSNLCSGSLITEQWVLTAAHCVKGYSASDFTVRGG 163

  Fly    84 AQN-HNYGGTLVPVAAYKVHEQFDSRFLHYDIAVLRLSTPLTFGLSTRAINLASTSPSGGTTVTV 147
            ... ....|....|::..|..:|.|:.::.|.|:|:|:..|| |.:...|::.:..|..|:.|.:
  Fly   164 TTTLDGSDGVTRSVSSIHVAPKFTSKKMNMDAALLKLNQSLT-GTNIGTISMGNYRPKAGSRVRI 227

  Fly   148 TGWGHTDNGA--LSDSLQKAQLQIIDRGECASQKFGYGADFVGEETI-----CAASTDADACTGD 205
            .|||.|..|:  .|.:||.||::::.:.:|..       |:.|:.||     ||.:...|:|:||
  Fly   228 AGWGVTKEGSTTASKTLQTAQIRVVRQQKCRK-------DYRGQATITKYMLCARAAGKDSCSGD 285

  Fly   206 SGGPLVASSQLVGIVSWGYRCADDNYPGVYADVAILRPW 244
            ||||:..::.|:||||:||.||...|||||..|..:|.|
  Fly   286 SGGPVTRNNTLLGIVSFGYGCARAGYPGVYTAVVAIRQW 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iotaTryNP_523695.1 Tryp_SPc 27..245 CDD:214473 75/226 (33%)
Tryp_SPc 28..247 CDD:238113 74/225 (33%)
CG32269NP_001261363.1 Tryp_SPc 108..324 CDD:214473 74/224 (33%)
Tryp_SPc 121..324 CDD:238113 69/211 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.