DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment iotaTry and CG32833

DIOPT Version :9

Sequence 1:NP_523695.1 Gene:iotaTry / 36223 FlyBaseID:FBgn0015001 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_726278.1 Gene:CG32833 / 37650 FlyBaseID:FBgn0052833 Length:268 Species:Drosophila melanogaster


Alignment Length:241 Identity:71/241 - (29%)
Similarity:117/241 - (48%) Gaps:20/241 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 DASDVEATGRIIGGSDQLIRNAPWQVSIQISARHECGGVIYSKEIIITAGHCLHERSVTLMKVRV 82
            |.:|...|  .:||....|..|||..||.|..:.:|.|.||....|:|||.|:......:::|||
  Fly    30 DENDCNRT--TLGGHPVNITTAPWIASISIKQKAKCDGAIYKLSHIVTAGKCVDGFLNKVIRVRV 92

  Fly    83 GAQNHNYGGTLVPVAAYKVHEQFDSRFLHYDIAVLRLSTPLTFGLSTRAINLASTSPSGGTTVTV 147
            |:...:.|...|.|....|||:|..:.:.:::|:|:|..||....:.:.|.||:..||.|..||.
  Fly    93 GSTTRSDGVIEVAVCNITVHEKFTGQTVFHNVAILKLCEPLEASKTIQPIQLANQLPSNGAKVTA 157

  Fly   148 TGWGH-----------TDNGALSDSLQKAQLQIIDRGECAS--QKFGYGADFVGEETICAASTDA 199
            .||..           .|:.|.  .||||:::::...:|..  .:..:......::..|......
  Fly   158 NGWPSFRWWAMYWKKCLDDEAY--KLQKAEVKLLGPSQCTDLWARNNWSKKNFTDDLFCTEKFAK 220

  Fly   200 DACTGDSGGPLVASSQLVGIVSWGYRCADDNYPGVYADVAILRPWI 245
            :||:...|.|:|.:.:||||::.| .|::  ||.||.::...:.|:
  Fly   221 EACSLAMGSPVVHNGKLVGIITKG-GCSE--YPEVYINLIKYKDWL 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iotaTryNP_523695.1 Tryp_SPc 27..245 CDD:214473 67/230 (29%)
Tryp_SPc 28..247 CDD:238113 68/231 (29%)
CG32833NP_726278.1 Tryp_SPc 40..266 CDD:238113 68/229 (30%)
Tryp_SPc 40..262 CDD:214473 67/226 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.