DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment iotaTry and CG11192

DIOPT Version :9

Sequence 1:NP_523695.1 Gene:iotaTry / 36223 FlyBaseID:FBgn0015001 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster


Alignment Length:259 Identity:85/259 - (32%)
Similarity:133/259 - (51%) Gaps:20/259 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VLVLLLLGDASDVEATGRIIGGSDQLIRNAPWQVSIQISARHECGGVIYSKEIIITAGHCLHER- 73
            ::.|:....|:.....|||:||....|:..|:|||:|:..||.|||.|...:.::||.||..:. 
  Fly    10 LMALVAYAGATPTPGDGRIVGGEVATIQEFPYQVSVQLQGRHICGGAIIGIDTVLTAAHCFEDPW 74

  Fly    74 SVTLMKVRVGAQNHNYGGTLVPVAAYKVHEQFDSRFLHYDIAVLRLSTPLTFGLSTRAINLASTS 138
            |.....||||:..|..||.::.:.....|..::.:....|:|:|.|:..|.|....:.:.||:.:
  Fly    75 SSADYTVRVGSSEHESGGHVLSLRRVIAHGDYNPQSHDNDLALLILNGQLNFTEHLQPVPLAALA 139

  Fly   139 --PSGGTTVTVTGWG-HTDNGA------LSDSLQKAQLQIIDRGECASQKFGYGADF-VGEETIC 193
              |:..|.:.|:||| ..:..|      :|..|:...:.:::..:|   :..|.... :....||
  Fly   140 DPPTADTRLQVSGWGFQAEESAVSGEVGVSPQLRFVDVDLVESNQC---RRAYSQVLPITRRMIC 201

  Fly   194 AASTDADACTGDSGGPLV------ASSQLVGIVSWGYRCADDNYPGVYADVAILRPWIVKAANA 251
            ||....|:|.||||||||      ..::|.||||||..||:.|:||||.:||..|.||.:..:|
  Fly   202 AARPGRDSCQGDSGGPLVGYAAEEGPARLYGIVSWGLGCANPNFPGVYTNVAAFRSWIDEQLDA 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iotaTryNP_523695.1 Tryp_SPc 27..245 CDD:214473 79/234 (34%)
Tryp_SPc 28..247 CDD:238113 80/235 (34%)
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 79/234 (34%)
Tryp_SPc 28..262 CDD:238113 80/236 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443267
Domainoid 1 1.000 148 1.000 Domainoid score I4330
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.