DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment iotaTry and thetaTry

DIOPT Version :9

Sequence 1:NP_523695.1 Gene:iotaTry / 36223 FlyBaseID:FBgn0015001 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster


Alignment Length:264 Identity:102/264 - (38%)
Similarity:148/264 - (56%) Gaps:23/264 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VATVLVLLLLGDA----------SDVEATGRIIGGSDQLIRNAPWQVSIQI-SARHECGGVIYSK 60
            :..:||.|.:|.|          ...|..|||:||.|..|...|:|||:|. |..|.|||.:.::
  Fly     4 LVVLLVCLAVGSACAGTVGVSNGDPFEREGRIVGGEDTTIGAHPYQVSLQTKSGSHFCGGSLINE 68

  Fly    61 EIIITAGHCLHERSVTLMKVRVGAQNHNYGGTLVPVAAYKVHEQFDSRFLHYDIAVLRLSTPLTF 125
            :.::||.|||..|.|:.:.||:|:..:|.||.:|.|.....:|.::|:.:.||:.:|:|...:..
  Fly    69 DTVVTAAHCLVGRKVSKVFVRLGSTLYNEGGIVVAVRELAYNEDYNSKTMEYDVGILKLDEKVKE 133

  Fly   126 GLSTRAINLASTSPSGGTTVTVTGWGH-------TDNGALSDSLQKAQLQIIDRGECASQKFGYG 183
            ..:.|.|.||:.:|..|||..|||||.       |    |..:||:..:.|:|...|||.::.||
  Fly   134 TENIRYIELATETPPTGTTAVVTGWGSKCYFWCMT----LPKTLQEVYVNIVDWKTCASDEYKYG 194

  Fly   184 ADFVGEETICAASTDADACTGDSGGPLVASSQLVGIVSWGYRCADDNYPGVYADVAILRPWIVKA 248
             :.:.:..:||.....|||.|||||||...:.|||||||||.||.:..||||:||..||.||:.|
  Fly   195 -EIIYDSMVCAYEKKKDACQGDSGGPLAVGNTLVGIVSWGYACASNLLPGVYSDVPALRKWILNA 258

  Fly   249 ANAI 252
            :..:
  Fly   259 SETL 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iotaTryNP_523695.1 Tryp_SPc 27..245 CDD:214473 92/225 (41%)
Tryp_SPc 28..247 CDD:238113 93/226 (41%)
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 92/225 (41%)
Tryp_SPc 35..255 CDD:238113 91/224 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452483
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 162 1.000 Inparanoid score I4193
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 1 1.000 - - otm49678
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
98.900

Return to query results.
Submit another query.