DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment iotaTry and PRSS41

DIOPT Version :9

Sequence 1:NP_523695.1 Gene:iotaTry / 36223 FlyBaseID:FBgn0015001 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001382429.1 Gene:PRSS41 / 360226 HGNCID:30715 Length:334 Species:Homo sapiens


Alignment Length:277 Identity:78/277 - (28%)
Similarity:113/277 - (40%) Gaps:82/277 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 EATGR------IIGGSDQLIRNAPWQVSIQISARHECGGVIYSKEIIITAGHCLHERSVTLMKVR 81
            ||.|.      :.||.:......|||.|:::..||.|||.:.|:..:::|.||.           
Human    60 EACGHREIHALVAGGVESARGRWPWQASLRLRRRHRCGGSLLSRRWVLSAAHCF----------- 113

  Fly    82 VGAQNHNYGG---------TLVPV--------AAYKVHEQFDS----RFLHYDIAVLRLSTPLTF 125
               |.|.|..         |..|.        :.|||.:...:    ..|..|||:|||::.:|:
Human   114 ---QKHYYPSEWTVQLGELTSRPTPWNLRAYSSRYKVQDIIVNPDALGVLRNDIALLRLASSVTY 175

  Fly   126 GLSTRAINLASTS------PSGGTTVTVTGWGHTDNGALSDS---------LQKAQLQIIDRGEC 175
            ....:.|.:.|::      |.    ..||||     |.:|.|         |::||:.|::...|
Human   176 NAYIQPICIESSTFNFVHRPD----CWVTGW-----GLISPSGTPLPPPYNLREAQVTILNNTRC 231

  Fly   176 ASQKFGY------GADFVGEETICAASTD--ADACTGDSGGPLVASSQ----LVGIVSWGYRCAD 228
                 .|      ....:.:...||.:.|  .|.|.||||||||....    .|||||||..|..
Human   232 -----NYLFEQPSSRSMIWDSMFCAGAEDGSVDTCKGDSGGPLVCDKDGLWYQVGIVSWGMDCGQ 291

  Fly   229 DNYPGVYADVAILRPWI 245
            .|.||||.::::...||
Human   292 PNRPGVYTNISVYFHWI 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iotaTryNP_523695.1 Tryp_SPc 27..245 CDD:214473 73/271 (27%)
Tryp_SPc 28..247 CDD:238113 75/266 (28%)
PRSS41NP_001382429.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.