DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment iotaTry and CG17571

DIOPT Version :9

Sequence 1:NP_523695.1 Gene:iotaTry / 36223 FlyBaseID:FBgn0015001 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster


Alignment Length:230 Identity:99/230 - (43%)
Similarity:145/230 - (63%) Gaps:3/230 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 GRIIGGSDQLIRNAPWQVSIQIS-ARHECGGVIYSKEIIITAGHCLHERSVTLMKVRVGAQNHNY 89
            |||:.|.|..|.|.|:|||:|.: ..|.|||.:...|.::||.||:...:.:.::||||:.:.:.
  Fly    29 GRIVNGEDVDIENYPYQVSVQTTKGSHFCGGSLIDSETVLTAAHCMQSYAASELQVRVGSTSRSS 93

  Fly    90 GGTLVPVAAYKVHEQFDSRFLHYDIAVLRLSTPLTFGLSTRAINLASTSPSGGTTVTVTGWGHTD 154
            ||.:|.|.|:|.||.::|:.:..|:|:::||:|:......|||.||.:....||...|:|||.|.
  Fly    94 GGEVVTVRAFKYHEGYNSKLMINDVAIIKLSSPVRQTSKIRAIELADSEAVSGTNAVVSGWGTTC 158

  Fly   155 NGALS--DSLQKAQLQIIDRGECASQKFGYGADFVGEETICAASTDADACTGDSGGPLVASSQLV 217
            ....|  |:|||.::.::...:||:..:.||:|.:.|..:||.....|||.|||||||||.::||
  Fly   159 FLFCSSPDTLQKVEVDLLHYKDCAADTYNYGSDSILETMVCATGEKKDACQGDSGGPLVADNKLV 223

  Fly   218 GIVSWGYRCADDNYPGVYADVAILRPWIVKAANAI 252
            |:||||..||...|||||||||.||.|||...:::
  Fly   224 GVVSWGSGCAWTGYPGVYADVASLRSWIVDTTDSL 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iotaTryNP_523695.1 Tryp_SPc 27..245 CDD:214473 95/220 (43%)
Tryp_SPc 28..247 CDD:238113 96/221 (43%)
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 95/220 (43%)
Tryp_SPc 31..254 CDD:238113 97/222 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443173
Domainoid 1 1.000 148 1.000 Domainoid score I4330
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 162 1.000 Inparanoid score I4193
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 1 1.000 - - otm49678
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
109.900

Return to query results.
Submit another query.