DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment iotaTry and Phae2

DIOPT Version :9

Sequence 1:NP_523695.1 Gene:iotaTry / 36223 FlyBaseID:FBgn0015001 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster


Alignment Length:276 Identity:83/276 - (30%)
Similarity:122/276 - (44%) Gaps:52/276 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VATVLVLLLL-----GDASDVEATGRIIGGSDQLIRNAPWQVSIQISARHECGGVIYSKEIIITA 66
            :||:|:|.:.     |.|.| :..||::||......:||:.||:|....|.|...|.:...::||
  Fly     7 LATILLLAVCVSQGSGLALD-QPEGRVVGGKAAAANSAPYIVSMQYGGTHYCAANIINSNWLVTA 70

  Fly    67 GHCLHERSVTLMKVRVGAQNHNYGGTLV----------------PVAAYKVHEQFDSRFLHYDIA 115
            .|||..|:..|            |.|||                .:..|.:::.:....:.|||.
  Fly    71 AHCLANRNQVL------------GSTLVAGSIAVAGTASTTQKRQITHYVINDLYTGGTVPYDIG 123

  Fly   116 VLRLSTPLTFGLSTRAINLASTSPSGGTTVT----VTGWG---HTDNGALSDSLQKAQ-LQIIDR 172
            ::...|..|:..:...:.|    ||.|...|    :.|||   .|::.:...:||:|: :.||..
  Fly   124 LIYTPTAFTWTAAVAPVKL----PSSGVRPTGKADLFGWGSTSKTNSPSYPKTLQEAKNIPIISL 184

  Fly   173 GECASQKFGYGADFVGEETICAA--STDADACTGDSGGPLVASSQLVGIVSWG-YRCADDNYPGV 234
            ..||:.....|.| |....:|..  :.....||.|||||||..:.|:|||||| ..|...|.|.|
  Fly   185 DSCAAALGSKGQD-VHTTNLCTGPLTGGTSFCTSDSGGPLVQGNVLIGIVSWGKLPCGQPNSPSV 248

  Fly   235 YADVAILRPWIVKAAN 250
            |..|:....||  |||
  Fly   249 YVQVSSFITWI--AAN 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iotaTryNP_523695.1 Tryp_SPc 27..245 CDD:214473 70/244 (29%)
Tryp_SPc 28..247 CDD:238113 71/245 (29%)
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 70/244 (29%)
Tryp_SPc 32..262 CDD:238113 72/248 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.