DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment iotaTry and Try29F

DIOPT Version :9

Sequence 1:NP_523695.1 Gene:iotaTry / 36223 FlyBaseID:FBgn0015001 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster


Alignment Length:262 Identity:92/262 - (35%)
Similarity:140/262 - (53%) Gaps:30/262 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GIVATVLVL----LLLGDASDVEAT-------GRIIGGSDQLIRNAPWQVSIQISARHECGGVIY 58
            |:..|:|.|    :||.:.| :.||       |||:||....|::.|:|||:|.| .|.|||.:.
  Fly     9 GMAKTILHLFIGGILLVNLS-LGATVRRPRLDGRIVGGQVANIKDIPYQVSLQRS-YHFCGGSLI 71

  Fly    59 SKEIIITAGHCLHERSVTLMKVRVGAQNHNYGGTLVPVAAYKVHEQFDSRFLHYDIAVLRLS--- 120
            ::..::||.||....::.|.|||:|:...:.||.||.:.....|.:||:..:.:|.::|.|.   
  Fly    72 AQGWVLTAAHCTEGSAILLSKVRIGSSRTSVGGQLVGIKRVHRHPKFDAYTIDFDFSLLELEEYS 136

  Fly   121 ----TPLTFGLSTRAINLASTSPSGGTTVTVTGWGHTDNG-ALSDSLQKAQLQIIDRGECASQKF 180
                |....||..:..::|.     ||.|.|:|||:|.:. ..|..|:...:..:.:.:|.....
  Fly   137 AKNVTQAFVGLPEQDADIAD-----GTPVLVSGWGNTQSAQETSAVLRSVTVPKVSQTQCTEAYG 196

  Fly   181 GYGADFVGEETICAASTDA--DACTGDSGGPLVASSQLVGIVSWGYRCADDNYPGVYADVAILRP 243
            .:|:  :.:..:||...:.  |||.|||||||.|...|.|:|||||.||..||||||:.|:.:|.
  Fly   197 NFGS--ITDRMLCAGLPEGGKDACQGDSGGPLAADGVLWGVVSWGYGCARPNYPGVYSRVSAVRD 259

  Fly   244 WI 245
            ||
  Fly   260 WI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iotaTryNP_523695.1 Tryp_SPc 27..245 CDD:214473 80/227 (35%)
Tryp_SPc 28..247 CDD:238113 81/228 (36%)
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 80/227 (35%)
Tryp_SPc 42..264 CDD:238113 81/228 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443285
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
65.850

Return to query results.
Submit another query.