DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment iotaTry and CG4271

DIOPT Version :9

Sequence 1:NP_523695.1 Gene:iotaTry / 36223 FlyBaseID:FBgn0015001 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_608665.1 Gene:CG4271 / 33410 FlyBaseID:FBgn0031409 Length:242 Species:Drosophila melanogaster


Alignment Length:251 Identity:79/251 - (31%)
Similarity:122/251 - (48%) Gaps:18/251 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IVATVLVLLLLGDASDVEATGRIIGGSDQLIRNAPWQVSIQISARHECGGVIYSKEIIITAGHCL 70
            ::.:..||:|...:|:     .|..|.:.......:..|:.:|..|||||.:....|::||..|:
  Fly     2 LIGSCWVLILFARSSN-----GIYNGVEAKFDFWTFLASVWVSGYHECGGAVIDSRIVLTAAQCV 61

  Fly    71 HERSVTLMKVRVGAQNHNYGGTLVPVAAYKVHEQFDSRFLHYDIAVLRLSTPLTFGLSTRA--IN 133
            ..:.|..:.||||..:...||.::.|.|..|||.:.:  ...|||:|.|..|:   ||.|.  |.
  Fly    62 KNKPVKRITVRVGTPDIYRGGRIIRVTALVVHENYKN--WDNDIALLWLEKPV---LSVRVTKIP 121

  Fly   134 LASTSPSGGTTVTVTGWGH--TDNGALSDSLQKAQLQIIDRGECASQKFGYGADFVGEETICAAS 196
            ||:..||.....:..|||.  .::..::..||....:|..|..||.:.    .:.||||.:||..
  Fly   122 LATKEPSENEYPSNAGWGEKLLESYVVTRKLQNGVTKIRPRSMCAEEL----VEPVGEELLCAFY 182

  Fly   197 TDADACTGDSGGPLVASSQLVGIVSWGYRCADDNYPGVYADVAILRPWIVKAANAI 252
            |:.|.|.||.|||||.::::|||...|:.|.....|.:|.:|.....||.:.|..:
  Fly   183 TENDICPGDYGGPLVLANKVVGIAVQGHGCGFAVLPSLYTNVFHYLEWIEENAEKL 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iotaTryNP_523695.1 Tryp_SPc 27..245 CDD:214473 72/221 (33%)
Tryp_SPc 28..247 CDD:238113 74/222 (33%)
CG4271NP_608665.1 Tryp_SPc 19..234 CDD:238113 74/223 (33%)
Tryp_SPc 19..231 CDD:214473 72/220 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.