DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment iotaTry and Ser12

DIOPT Version :9

Sequence 1:NP_523695.1 Gene:iotaTry / 36223 FlyBaseID:FBgn0015001 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster


Alignment Length:252 Identity:108/252 - (42%)
Similarity:145/252 - (57%) Gaps:15/252 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAVYGIVATVLVLLLLGDASDVEATGRIIGGSDQLIRNAPWQVSIQISARHECGGVIYSKEIIIT 65
            |.::.:|....|.|:...:|    ..||:||...||...|||.::..|.::.||.||||.:||||
  Fly     1 MLLHWLVLVASVTLISAGSS----PERIVGGHPVLISEVPWQAALMYSEKYICGAVIYSDKIIIT 61

  Fly    66 AGHCLHERSVTLMKVRVGAQNHNYGGTLVPVAAYKVHEQF-DSRFLHYDIAVLRLSTPLTFGLST 129
            |.||:.....||..||||:...|.||....||..:.||.: .|..|..||||:||...|.|....
  Fly    62 AAHCVERPFDTLYSVRVGSVWKNLGGQHARVAVIRKHEDYVSSTILFNDIAVIRLVDTLIFNAEV 126

  Fly   130 RAINLASTSPSGGTTVTVTGWGHTDNGAL---SDSLQKAQLQIIDRGECASQKFGYGADFVGEET 191
            |.|.||.::|:.||..:|:|||  :.|.|   ..||.|..::|:|...|   |..|  .::.:..
  Fly   127 RPIQLADSAPAAGTEASVSGWG--EIGILWLQPTSLLKTSVKILDPNVC---KRSY--QYITKTM 184

  Fly   192 ICAASTDADACTGDSGGPLVASSQLVGIVSWGYRCADDNYPGVYADVAILRPWIVKA 248
            ||||:...|:|.||||||||:..|||||||:|..||:..:|||||:||.|:|||:.|
  Fly   185 ICAAALLKDSCHGDSGGPLVSGGQLVGIVSYGIGCANPFFPGVYANVAELKPWILNA 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iotaTryNP_523695.1 Tryp_SPc 27..245 CDD:214473 100/221 (45%)
Tryp_SPc 28..247 CDD:238113 101/222 (45%)
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 100/221 (45%)
Tryp_SPc 24..238 CDD:238113 99/220 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443179
Domainoid 1 1.000 156 1.000 Domainoid score I4174
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 152 1.000 Inparanoid score I4263
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.