DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment iotaTry and Ser6

DIOPT Version :9

Sequence 1:NP_523695.1 Gene:iotaTry / 36223 FlyBaseID:FBgn0015001 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster


Alignment Length:260 Identity:88/260 - (33%)
Similarity:125/260 - (48%) Gaps:23/260 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YGIVATVLVLLLLGDASDVEA-----TGRIIGGSDQLIRNAPWQVSIQISARHECGGVIYSKEII 63
            :|.||.:|...||.....|::     .||::||.|.:....|.|||::.:..|.|||.|.::..|
  Fly     3 FGKVAILLCSFLLFLVLPVQSAPGKLNGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILTRTYI 67

  Fly    64 ITAGHCLHERSVT---------LMKVRVGAQNHNYGGTLVPVAAYKVHEQFDSRFLHYDIAVLRL 119
            :||.||:....|.         ...:|.|:.:...||.||.||...|||:: ..||: |:|:|||
  Fly    68 LTAAHCVSNEDVNHVITPIAAERFTIRAGSNDRFSGGVLVQVAEVIVHEEY-GNFLN-DVALLRL 130

  Fly   120 STPLTFGLSTRAINLASTSPSGGTTVTVTGWGHTDN-GALSDSLQKAQLQIIDRGECASQKFGYG 183
            .:||....|.:.|:|.:........|.::|||...: |.|...||...|:.|.|.:|...     
  Fly   131 ESPLILSASIQPIDLPTVDTPADVDVVISGWGRIKHQGDLPRYLQYNTLKSITRQQCEEL----- 190

  Fly   184 ADFVGEETICAA-STDADACTGDSGGPLVASSQLVGIVSWGYRCADDNYPGVYADVAILRPWIVK 247
            .||..|..:|.. ..|..||.||||||.|.::||||:..:........||..||.|...:.||.|
  Fly   191 IDFGFEGELCLLHQVDNGACNGDSGGPAVYNNQLVGVAGFVVDGCGSTYPDGYARVFYFKDWIKK 255

  Fly   248  247
              Fly   256  255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iotaTryNP_523695.1 Tryp_SPc 27..245 CDD:214473 77/228 (34%)
Tryp_SPc 28..247 CDD:238113 78/229 (34%)
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 77/228 (34%)
Tryp_SPc 32..256 CDD:238113 79/231 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.