DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment iotaTry and Prss53

DIOPT Version :9

Sequence 1:NP_523695.1 Gene:iotaTry / 36223 FlyBaseID:FBgn0015001 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001074737.1 Gene:Prss53 / 330657 MGIID:2652890 Length:552 Species:Mus musculus


Alignment Length:235 Identity:61/235 - (25%)
Similarity:103/235 - (43%) Gaps:44/235 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 PWQVSIQISARHECGGVIYSKEIIITAGHC--------LHERSVTLMKVRVGAQNHNYGGTLVPV 96
            |||.|::....|.|.|.:.:...::||.||        |...||.|..::...|:.  |...|.|
Mouse    49 PWQASVRRQGVHICSGSLVADTWVLTAAHCFEKMATAELSSWSVVLGSLKQEGQSP--GAEEVGV 111

  Fly    97 AAYKVHEQFDSRFLHY----DIAVLRLSTPLTFGLSTRAINLASTSPS----GGTTVTVTGWGHT 153
            ||.::.:.::    ||    |:|:|:|:.|      |....|....|:    .|.:...|||.. 
Mouse   112 AALQLPKAYN----HYSQGSDLALLQLTHP------TVQTTLCLPQPTYHFPFGASCWATGWDQ- 165

  Fly   154 DNGALSDSLQKAQLQIIDRGEC------ASQKFGYGADFVGEETICAASTDAD--ACTGDSGGPL 210
            :...:|.:|:..:|::|.|..|      ..|:........|  .:|..:...:  .|.||||||:
Mouse   166 NTSDVSRTLRNLRLRLISRPTCNCLYNRLHQRLLSNPARPG--MLCGGAQPGEQGPCQGDSGGPV 228

  Fly   211 VASSQ-----LVGIVSWGYRCADDNYPGVYADVAILRPWI 245
            :....     .|||:|:..:||.::.|.:..|:|:...|:
Mouse   229 MCREPDGHWVQVGIISFTSKCAQEDTPVLLTDMAVHSSWL 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iotaTryNP_523695.1 Tryp_SPc 27..245 CDD:214473 60/233 (26%)
Tryp_SPc 28..247 CDD:238113 61/235 (26%)
Prss53NP_001074737.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 27..46
Tryp_SPc 45..271 CDD:238113 61/235 (26%)
Tryp_SPc 311..522 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839503
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.