DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment iotaTry and Prss34

DIOPT Version :9

Sequence 1:NP_523695.1 Gene:iotaTry / 36223 FlyBaseID:FBgn0015001 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_848459.1 Gene:Prss34 / 328780 MGIID:2681414 Length:318 Species:Mus musculus


Alignment Length:244 Identity:72/244 - (29%)
Similarity:110/244 - (45%) Gaps:27/244 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 IIGGSDQLIRNAPWQVSIQI------SARHECGGVIYSKEIIITAGHCLHERSVTL--MKVRVGA 84
            |:||........|||||:::      ...|||||.:...:.::||.||:..:.|..  ::|:||.
Mouse    35 IVGGCPVSASRFPWQVSLRLYDMEHSRWEHECGGSLIHPQWVLTAAHCVRPKEVEAYGVRVQVGQ 99

  Fly    85 QNHNYGGTLVPVAAYKVHEQFDSRFL---HYDIAVLRLSTPLTFGLSTRAINL--ASTSPSGGTT 144
            ........|:.|.....|.:|..:..   ..|||:|:|.|.:........::|  ||...|...|
Mouse   100 LRLYENDQLMKVVKIIRHPKFSEKLSARGGADIALLKLDTRVVLSEHVYPVSLPAASLRISSKKT 164

  Fly   145 VTVTGWGHTDNGALSD---SLQKAQLQIIDRGECASQKFGYGAD------FVGEETICAASTDAD 200
            ..|.|||..:|.....   .|::..:.|::..:| .||:...:.      .:.::.:||.....|
Mouse   165 CWVAGWGVIENYMPLPPPYHLREVAVPIVENNDC-EQKYQTNSSSDSTTRIIKDDMLCAGKEGRD 228

  Fly   201 ACTGDSGGPLV----ASSQLVGIVSWGYRCADDNYPGVYADVAILRPWI 245
            :|..|||||||    .|...||:||||..|...::||||..|.....||
Mouse   229 SCKADSGGPLVCRWNCSWVQVGVVSWGIGCGLPDFPGVYTRVMSYVSWI 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iotaTryNP_523695.1 Tryp_SPc 27..245 CDD:214473 70/242 (29%)
Tryp_SPc 28..247 CDD:238113 72/244 (30%)
Prss34NP_848459.1 Tryp_SPc 35..278 CDD:238113 72/244 (30%)
Tryp_SPc 35..277 CDD:214473 70/242 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.