DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment iotaTry and CG9672

DIOPT Version :9

Sequence 1:NP_523695.1 Gene:iotaTry / 36223 FlyBaseID:FBgn0015001 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_573151.1 Gene:CG9672 / 32651 FlyBaseID:FBgn0030777 Length:253 Species:Drosophila melanogaster


Alignment Length:225 Identity:63/225 - (28%)
Similarity:106/225 - (47%) Gaps:17/225 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IVATVLVLLLLGDASDVEATGRIIGGSDQLIRNAPWQVSIQISARHECGGVIYSKEIIITAGHCL 70
            :..|:.::|:.....:.:..|||.||.|.::...|:|.::.|...:.||.||..:...:||..|:
  Fly     3 LTLTIGLILVAAGVLEAQPQGRIAGGEDAVLGQLPYQAALSIGGSYNCGAVIIGQRYALTALSCV 67

  Fly    71 HER------SVTLMKVRVGAQNHNYGGTLVPVAAYKVHEQFDSRFLHYDIAVLRLSTPLTFGLST 129
            ...      :..|..|.||:.: .|.|..:.|....::..:.:  |...||:|||...:||..:.
  Fly    68 CSDGKDTPWAAVLFAVTVGSVD-LYNGKQIRVEEITINPNYST--LKTGIALLRLQEEITFSETV 129

  Fly   130 RAINLASTSPSGGTTVTVTGWGHTDNGALS--DSLQKAQLQIIDRGEC--ASQKFGYGADFVGEE 190
            .||.|:...|..|:.|.|:|||.|....::  .:||....:::...||  |::.....||   ::
  Fly   130 NAIPLSQDVPPMGSQVEVSGWGRTTESEVNMHRTLQIGAAEVMAPRECALANRDELLVAD---DQ 191

  Fly   191 TICAA-STDADACTGDSGGPLVASSQLVGI 219
            .:|.. ......|:||.|||.|...||||:
  Fly   192 VLCLGHGRRQGICSGDIGGPAVYQGQLVGL 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iotaTryNP_523695.1 Tryp_SPc 27..245 CDD:214473 60/204 (29%)
Tryp_SPc 28..247 CDD:238113 59/203 (29%)
CG9672NP_573151.1 Tryp_SPc 24..247 CDD:214473 60/204 (29%)
Tryp_SPc 25..250 CDD:238113 59/203 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.