DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment iotaTry and sphe

DIOPT Version :9

Sequence 1:NP_523695.1 Gene:iotaTry / 36223 FlyBaseID:FBgn0015001 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster


Alignment Length:244 Identity:69/244 - (28%)
Similarity:114/244 - (46%) Gaps:15/244 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VLVLLLLGDASDVEATGRIIGGSDQLIRNAPWQVSIQISARHECGGVIYSKEIIITAGHCLHER- 73
            :|.|:.|.......|.|||:||.|.......:..|:::...|.|||.|.|:..|:|..||:|.. 
  Fly     8 ILGLIGLTAVGMCHAQGRIMGGEDADATATTFTASLRVDNAHVCGGSILSQTKILTTAHCVHRDG 72

  Fly    74 ---SVTLMKVRVGAQNHNYGGTLVPVAAYKVHEQFDSRFLHYDIAVLRLSTPLTFGLSTRAINLA 135
               ..:.:..|||:.|...||.:|.|.:..||..:.:  |:.::||:.||:.||:.....||.|.
  Fly    73 KLIDASRLACRVGSTNQYAGGKIVNVESVAVHPDYYN--LNNNLAVITLSSELTYTDRITAIPLV 135

  Fly   136 STS---PSGGTTVTVTGWGHTDNGALSDSLQKAQLQIIDRGECASQKFGYGADFVGEETICAA-S 196
            ::.   |:.|:.|.|.|||.|.:|..|..:::..|::.....|......:     .|::.|.| .
  Fly   136 ASGEALPAEGSEVIVAGWGRTSDGTNSYKIRQISLKVAPEATCLDAYSDH-----DEQSFCLAHE 195

  Fly   197 TDADACTGDSGGPLVASSQLVGIVSWGYRCADDNYPGVYADVAILRPWI 245
            .....|.||.||..:..:.|:|:.::........||.|:..::....||
  Fly   196 LKEGTCHGDGGGGAIYGNTLIGLTNFVVGACGSRYPDVFVRLSSYADWI 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iotaTryNP_523695.1 Tryp_SPc 27..245 CDD:214473 62/225 (28%)
Tryp_SPc 28..247 CDD:238113 63/226 (28%)
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 59/210 (28%)
Tryp_SPc 42..244 CDD:214473 57/208 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.