DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment iotaTry and CG9676

DIOPT Version :9

Sequence 1:NP_523695.1 Gene:iotaTry / 36223 FlyBaseID:FBgn0015001 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster


Alignment Length:250 Identity:83/250 - (33%)
Similarity:125/250 - (50%) Gaps:14/250 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 TVLVLLLLG--DASDVEATGRIIGGSDQLIRNAPWQVSIQISARHECGGVIYSKEIIITAGHCLH 71
            ::|||...|  ..:|.....||:||:.......|.|:|::....|.|||.|.||:.::||.||:.
  Fly     7 SLLVLCAAGVLAQNDSVVEPRIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAHCVK 71

  Fly    72 ERS----VTLMKVRVGAQNHNYGGTLVPVAAYKVHEQFDSRFLHYDIAVLRLSTPLTFGLSTRAI 132
            :.:    ...::::.|:...:.||..||||...||..::|.  .:|:|||||...|||..:..||
  Fly    72 QGNNVAPANELEIQAGSLLLSSGGVRVPVATVTVHPNYNSN--GHDVAVLRLRNSLTFNSNIAAI 134

  Fly   133 NLASTSPSGGTTVTVTGWGH-TDNGALSDSLQKAQLQIIDRGECASQKFGYGADFVGEETICAA- 195
            .||:..|....||.::|||. :..|.:|:||...|::.:.|..|.......    :.|.|:|.. 
  Fly   135 KLATEDPPNDATVDISGWGAISQRGPISNSLLYVQVKALSRESCQKTYLRQ----LPETTMCLLH 195

  Fly   196 STDADACTGDSGGPLVASSQLVGIVSWGYRCADDNYPGVYADVAILRPWIVKAAN 250
            ..|..||.||||||.....:|||:.|:.........|..|..|:.||.||.:.|:
  Fly   196 PKDKGACYGDSGGPATYQGKLVGLASFVIGGCGRAAPDGYERVSKLRNWIAEKAS 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iotaTryNP_523695.1 Tryp_SPc 27..245 CDD:214473 75/223 (34%)
Tryp_SPc 28..247 CDD:238113 76/224 (34%)
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 75/223 (34%)
Tryp_SPc 28..248 CDD:238113 76/225 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.