DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment iotaTry and CG33159

DIOPT Version :9

Sequence 1:NP_523695.1 Gene:iotaTry / 36223 FlyBaseID:FBgn0015001 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster


Alignment Length:235 Identity:71/235 - (30%)
Similarity:115/235 - (48%) Gaps:13/235 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LVLLLLGDASDVEATGRIIGGSDQLIRNAPWQVSIQISARHECGGVIYSKEIIITAGHCLHERSV 75
            |.|:|...:|..    ||:||.:..|...|:.|.::.:....|||.:.|...:::|.||::....
  Fly    13 LALVLPSSSSKT----RIVGGKETTISEVPYLVYLRQNGYFICGGSLISSRAVLSAAHCVYGSQP 73

  Fly    76 TLMKVRVGAQNHNYGGTLV-PVAAYKVHEQFDSRFLHYDIAVLRLS--TPLTFGLSTRAINLAST 137
            ....|..||...:....:| .|..:.....:.:.....|:|:|:|.  ..||.| ....|:....
  Fly    74 EGFTVHAGASRLDQEAPVVRNVVMFHTSPSYSATNFDMDVALLQLQEVVVLTPG-KVATISPCRN 137

  Fly   138 SPSGGTTVTVTGWGHT--DNGALSDSLQKAQLQIIDRGECASQKFGYGADFVGEETICAASTD-A 199
            .|.|.....::|||.|  :|...::.::...::::...||.....|||.  :.:..:|||... .
  Fly   138 PPEGNAYARISGWGVTRENNREPAEQVRTTMVRVLPGAECKISYSGYGQ--LSDSMLCAAVRGLR 200

  Fly   200 DACTGDSGGPLVASSQLVGIVSWGYRCADDNYPGVYADVA 239
            |:|:||||||||...|:.||||||:.||..::||||.:||
  Fly   201 DSCSGDSGGPLVYRGQVCGIVSWGFGCARPSFPGVYTNVA 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iotaTryNP_523695.1 Tryp_SPc 27..245 CDD:214473 67/219 (31%)
Tryp_SPc 28..247 CDD:238113 66/218 (30%)
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 67/219 (31%)
Tryp_SPc 26..251 CDD:238113 66/218 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D114140at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.