DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment iotaTry and CG32834

DIOPT Version :9

Sequence 1:NP_523695.1 Gene:iotaTry / 36223 FlyBaseID:FBgn0015001 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001188996.1 Gene:CG32834 / 318238 FlyBaseID:FBgn0052834 Length:556 Species:Drosophila melanogaster


Alignment Length:259 Identity:86/259 - (33%)
Similarity:131/259 - (50%) Gaps:20/259 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VYGIVATVLVLLLLGDASDVEATGRIIGGSDQLIRNAPWQVSIQISARHECGGVIYSKEIIITAG 67
            ::.:...:|..||.....|::|..|||||.|..|.:||:|..:.|.....|.|.|.:.:.||||.
  Fly     2 IWSVFLFLLAALLRPVRGDLDAQSRIIGGYDVDIEDAPYQAEVIIDGTAICSGAIITSDTIITAA 66

  Fly    68 HCLHERSVTLMKVRVGAQNHNYGGT--LVPVAAYKVHEQFDSRFLHYDIAVLRLSTPLTFGLSTR 130
            .|:  :|...::||||..:.:|.||  |:.|.....|.|::......::|:|:|..||....:.:
  Fly    67 SCV--QSYGSIEVRVGTSSRDYDGTGFLLEVCEIINHPQYNCWRFDNNLALLKLCDPLKTSEAIQ 129

  Fly   131 AINLASTSPSGGTTVTVTGWGHTD---------NGALSDSLQKAQLQIIDRGECASQK---FGYG 183
            .|::|...|..|:..||:|||.|.         .|:|.|.||.|.:.:.:|.:||:.:   ||..
  Fly   130 PISIAEDEPDDGSWCTVSGWGSTSWWGSWWDRCFGSLPDYLQMAWVSVYNREQCAADRGVWFGLW 194

  Fly   184 ADFVGEETICAASTDADACTGDSGGPLVASSQLVGIVSWGYRCADDNYPGVYADVAILRPWIVK 247
            .:.:...|:| ....|..|:.|:|.|||...|||||:|.| .|.  ..|.|||:|.....||.:
  Fly   195 DNGISYLTLC-THNGAGGCSYDTGAPLVIDGQLVGILSEG-GCT--TKPDVYANVPWFTGWIAE 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iotaTryNP_523695.1 Tryp_SPc 27..245 CDD:214473 79/231 (34%)
Tryp_SPc 28..247 CDD:238113 80/232 (34%)
CG32834NP_001188996.1 Tryp_SPc 26..252 CDD:214473 79/231 (34%)
Tryp_SPc 27..255 CDD:238113 80/234 (34%)
BES1_N <293..343 CDD:283367
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.