DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment iotaTry and CG32523

DIOPT Version :9

Sequence 1:NP_523695.1 Gene:iotaTry / 36223 FlyBaseID:FBgn0015001 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster


Alignment Length:260 Identity:91/260 - (35%)
Similarity:129/260 - (49%) Gaps:25/260 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 TVLVLLLLG-----------DASDVEATGRIIGGSDQLIRNAPWQVSIQISARHECGGVIYSKEI 62
            |||:|||.|           :.|:.....||:||........|.|:|:::...|.|||||.|...
  Fly     7 TVLLLLLCGVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATH 71

  Fly    63 IITAGHCL-HERSVT---LMKVRVGAQNHNYGGTLVPVAAYKVHEQFDSRFLHYDIAVLRLSTPL 123
            :||||||: |...|.   |..::.|:...:..|..:|||...:|..:.:.. |.|:|||||.:||
  Fly    72 VITAGHCVKHGNDVVPADLWSIQAGSLLLSSDGVRIPVAEVIMHPNYATGG-HNDLAVLRLQSPL 135

  Fly   124 TFGLSTRAINLASTSPSGGTTVTVTGWGH-TDNGALSDSLQKAQLQIIDRGECASQKFGYGADFV 187
            ||..:..||.||:..|.....|.::|||: .:.|.|||||...|:..|.||.|....:..    :
  Fly   136 TFDANIAAIQLATEDPPNCVAVDISGWGNIAEKGPLSDSLLFVQVTSISRGACRWMFYSR----L 196

  Fly   188 GEETICAA-STDADACTGDSGGPLVASSQLVGIVS--WGYRCADDNYPGVYADVAILRPWIVKAA 249
            .|..||.. |.::.||.||||||.....::||:.|  .|..|. ...|..|..::.:|.||.:.|
  Fly   197 PETMICLLHSKNSGACYGDSGGPATYGGKVVGLASLLLGGGCG-RAAPDGYLRISKVRAWIAEKA 260

  Fly   250  249
              Fly   261  260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iotaTryNP_523695.1 Tryp_SPc 27..245 CDD:214473 80/225 (36%)
Tryp_SPc 28..247 CDD:238113 81/226 (36%)
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 80/225 (36%)
Tryp_SPc 37..219 CDD:238113 69/186 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.