DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment iotaTry and CG32376

DIOPT Version :9

Sequence 1:NP_523695.1 Gene:iotaTry / 36223 FlyBaseID:FBgn0015001 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_729271.1 Gene:CG32376 / 318002 FlyBaseID:FBgn0052376 Length:291 Species:Drosophila melanogaster


Alignment Length:273 Identity:92/273 - (33%)
Similarity:127/273 - (46%) Gaps:55/273 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLLGDASDVEAT----------------------GRIIGGSDQLIRNAPWQVSIQISARHECGGV 56
            ||.|...|:..|                      .||:.|.......||:|.|:.......||.|
  Fly    30 LLYGKPEDIAPTPNFGNISSNPFINALEAQESFPTRIVNGKRIPCTEAPFQGSLHYEGYFVCGCV 94

  Fly    57 IYSKEIIITAGHCLH---ERSVTLMKVRVGAQNHNYGGTL------VPVAAYKVHEQFDSRFLHY 112
            |.:|..|:||.||..   |:    ..||||:.....||.|      |.:|||..:.      :.:
  Fly    95 IINKIWILTAHHCFFGPPEK----YTVRVGSDQQRRGGQLRHVKKIVALAAYNDYT------MRH 149

  Fly   113 DIAVLRLSTPLTFGLSTRAINLASTSPSGGTT-----VTVTGWGHTDNGA--LSDSLQKAQLQII 170
            |:|:::|.:|:.||...|.:.|.||.    ||     ..|:|||.|...|  :...|::.|:..|
  Fly   150 DLAMMKLKSPVYFGKCVRPVKLPSTK----TTKFPKKFVVSGWGITSANAQNVQRYLRRVQIDYI 210

  Fly   171 DRGECASQKFGYGADF-VGEETICAASTDADACTGDSGGPLVASSQLVGIVSWGYRCADDNYPGV 234
            .|.:|  ||....|.. :.::.|||:.|:.|:|:|||||||.:...|.||||||..||:.|||||
  Fly   211 KRSKC--QKMYKKAGLKIYKDMICASRTNKDSCSGDSGGPLTSRGVLYGIVSWGIGCANKNYPGV 273

  Fly   235 YADVAILRPWIVK 247
            |.:.....|||.|
  Fly   274 YVNCKRYVPWIKK 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iotaTryNP_523695.1 Tryp_SPc 27..245 CDD:214473 84/234 (36%)
Tryp_SPc 28..247 CDD:238113 85/235 (36%)
CG32376NP_729271.1 Tryp_SPc 65..284 CDD:214473 84/234 (36%)
Tryp_SPc 66..287 CDD:238113 86/237 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
43.910

Return to query results.
Submit another query.