DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment iotaTry and Klk14

DIOPT Version :9

Sequence 1:NP_523695.1 Gene:iotaTry / 36223 FlyBaseID:FBgn0015001 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_777355.1 Gene:Klk14 / 317653 MGIID:2447564 Length:250 Species:Mus musculus


Alignment Length:252 Identity:84/252 - (33%)
Similarity:126/252 - (50%) Gaps:25/252 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VLVLLLLGDASDV-----EATGRIIGGSDQLIRNA-PWQVSIQISARHE--CGGVIYSKEIIITA 66
            :.:||::..|..|     :...:||||. :.:||: ||||::|....|.  ||||:.|.:.:|||
Mouse     1 MFLLLIILQALAVAIAQSQGDHKIIGGY-RCVRNSQPWQVALQAGPGHRFLCGGVLLSDQWVITA 64

  Fly    67 GHCLHERSVTLMKVRVGAQN-HNYGGT--LVPVAAYKVHEQFDSRFLHYDIAVLRLSTPLTFGLS 128
            .||..    .::.|.:|..| ..:..|  :|.||....|.|:..:....|:.:|:|...:..|.:
Mouse    65 AHCAR----PILHVALGKHNIRRWEATQQVVRVARQVPHPQYQPQAHDNDLMLLKLQKKVRLGRA 125

  Fly   129 TRAINLASTSPSGGTTVTVTGWGHTDN--GALSDSLQKAQLQIIDRGECASQKFGYGADFVGEET 191
            .:.|::||:..|.||...|:|||...:  .....:||...:.|:....|.....|    .:....
Mouse   126 VKTISVASSCASPGTPCRVSGWGTIASPIARYPTALQCVNVNIMSEQACHRAYPG----IITSGM 186

  Fly   192 ICAASTDA--DACTGDSGGPLVASSQLVGIVSWGY-RCADDNYPGVYADVAILRPWI 245
            :||...:.  |:|.||||||||...||.|:||||. |||...||||||::.....||
Mouse   187 VCAGVPEGGKDSCQGDSGGPLVCGGQLQGLVSWGMERCAMPGYPGVYANLCNYHSWI 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iotaTryNP_523695.1 Tryp_SPc 27..245 CDD:214473 78/228 (34%)
Tryp_SPc 28..247 CDD:238113 80/229 (35%)
Klk14NP_777355.1 Tryp_SPc 24..246 CDD:238113 80/229 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 156 1.000 Domainoid score I4174
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.