DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment iotaTry and Klk15

DIOPT Version :9

Sequence 1:NP_523695.1 Gene:iotaTry / 36223 FlyBaseID:FBgn0015001 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_777354.1 Gene:Klk15 / 317652 MGIID:2447533 Length:254 Species:Mus musculus


Alignment Length:254 Identity:81/254 - (31%)
Similarity:112/254 - (44%) Gaps:35/254 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LLLLGDASDVEATGRIIGGSDQLIRNAPWQVSIQISARHECGGVIYSKEIIITAGHCLHERSVTL 77
            :||:..|.|.:   :::.|.:.:..:.||||::....|..||..:.|...::||.||    ....
Mouse     8 VLLVSAAQDGD---KVLEGEECVPHSQPWQVALFERGRFNCGAFLISPRWVLTAAHC----QTRF 65

  Fly    78 MKVRVGAQN-HNYGG--TLVPVAAYKVHEQFDSRFLHYDIAVLRLSTPLTFGLSTRAINLASTSP 139
            |:||:|..| ..:.|  .|..|:....|..:::|...:||.:|||..|.......|.:.|....|
Mouse    66 MRVRLGEHNLRKFDGPEQLRSVSRIIPHPGYEARTHRHDIMLLRLFKPARLTAYVRPVALPRRCP 130

  Fly   140 SGGTTVTVTGWG-HTDN--GA---------LSDSLQKAQLQIIDRGECASQKFGYGADFVGE--- 189
            ..|....|:||| .:||  ||         |.|:|..|.:.||....|       ..|:.|.   
Mouse   131 LIGEDCVVSGWGLLSDNNPGATGSQKSHVRLPDTLHCANISIISEASC-------NKDYPGRVLP 188

  Fly   190 ETICAA--STDADACTGDSGGPLVASSQLVGIVSWG-YRCADDNYPGVYADVAILRPWI 245
            ..:||.  ....|:|.||||||||....|.|||||| ..|.....||||..|.....||
Mouse   189 TMVCAGVEGGGTDSCEGDSGGPLVCGGALQGIVSWGDVPCDTTTKPGVYTKVCSYLEWI 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iotaTryNP_523695.1 Tryp_SPc 27..245 CDD:214473 75/238 (32%)
Tryp_SPc 28..247 CDD:238113 77/239 (32%)
Klk15NP_777354.1 Tryp_SPc 23..247 CDD:238113 75/234 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 156 1.000 Domainoid score I4174
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.