DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment iotaTry and LOC312273

DIOPT Version :9

Sequence 1:NP_523695.1 Gene:iotaTry / 36223 FlyBaseID:FBgn0015001 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001101326.1 Gene:LOC312273 / 312273 RGDID:1563848 Length:246 Species:Rattus norvegicus


Alignment Length:225 Identity:69/225 - (30%)
Similarity:105/225 - (46%) Gaps:15/225 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RIIGGSDQLIRNAPWQVSIQISARHECGGVIYSKEIIITAGHCLHERSVTLMKVRVGAQN-HNYG 90
            ||:||......:.|:|||:. :..|.|||.:.:.:.:::|.||.|.:    ::||:|..| :...
  Rat    24 RIVGGYTCQEHSVPYQVSLN-AGSHICGGSLITDQWVLSAAHCYHPQ----LQVRLGEHNIYEIE 83

  Fly    91 GT--LVPVAAYKVHEQFDSRFLHYDIAVLRLSTPLTFGLSTRAINLASTSPSGGTTVTVTGWGHT 153
            |.  .:..|...:|..:|...:..||.:::|.:|.|.......|.|....|:.||...|:|||..
  Rat    84 GAEQFIDAAKMILHPDYDKWTVDNDIMLIKLKSPATLNSKVSTIPLPQYCPTAGTECLVSGWGVL 148

  Fly   154 DNGALSDS-LQKAQLQIIDRGECASQKFGYGADFVGEETICAASTDA--DACTGDSGGPLVASSQ 215
            ..|..|.| ||.....::....|..   .|... :.....|....:.  |:|..|||||:|.:.:
  Rat   149 KFGFESPSVLQCLDAPVLSDSVCHK---AYPRQ-ITNNMFCLGFLEGGKDSCQYDSGGPVVCNGE 209

  Fly   216 LVGIVSWGYRCADDNYPGVYADVAILRPWI 245
            :.||||||..||.:..||||..|.....||
  Rat   210 VQGIVSWGDGCALEGKPGVYTKVCNYLNWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iotaTryNP_523695.1 Tryp_SPc 27..245 CDD:214473 67/223 (30%)
Tryp_SPc 28..247 CDD:238113 68/224 (30%)
LOC312273NP_001101326.1 Tryp_SPc 25..242 CDD:238113 68/224 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 152 1.000 Inparanoid score I4263
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.