DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment iotaTry and CG3795

DIOPT Version :9

Sequence 1:NP_523695.1 Gene:iotaTry / 36223 FlyBaseID:FBgn0015001 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001284790.1 Gene:CG3795 / 31128 FlyBaseID:FBgn0025378 Length:305 Species:Drosophila melanogaster


Alignment Length:260 Identity:72/260 - (27%)
Similarity:112/260 - (43%) Gaps:51/260 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 SDVE--ATGRIIGGSDQLIRNAPWQVSIQISA-------RHECGGVIYSKEIIITAGHCL--HER 73
            ||.:  .||.....::.|::   :.||:::..       .|.|.|.|:|:..|:||.||:  :.|
  Fly    40 SDFQFLVTGGYRPDTNDLVK---YTVSLRMGKPKKFFGDNHFCAGTIFSERAILTAAHCMFSNRR 101

  Fly    74 SVTLMKVRVGAQNHNYGGT-----------------LVPVAAYKVHEQFDSRFLHYDIAVLRLST 121
            .:...|:.|.|      ||                 |:|...||     ..:...|||.::.|..
  Fly   102 KLKAKKLMVVA------GTPRRLLKSSTTQIIEAEELLPHPKYK-----KGKSQKYDIGLILLEA 155

  Fly   122 PLTFGLSTRAINLASTSPSGGTTVTVTGWGHT-DNGALSDSLQKAQLQIIDRGECASQKFGYGAD 185
            .|:.|.:...|.|.:..|..|...::.|||.. ..|.|.|......:||:....| .:..|:.  
  Fly   156 DLSLGDAVAKIPLYNKVPVAGAPCSIVGWGTVIQFGPLPDEAINGDMQILPDTFC-EKLLGWS-- 217

  Fly   186 FVGEETICA---ASTDADACTGDSGGPLVASSQLVGIVSWGYRCADDNYPGVYADVAILRPWIVK 247
              ....:||   ..:|.|:|.|||||||:..:.:.||||:|..|.:.:..|:|.||...|.||.:
  Fly   218 --NAGMLCANDKHDSDVDSCQGDSGGPLICDNMVTGIVSFGMGCGEPDSAGIYTDVYHFRDWITE 280

  Fly   248  247
              Fly   281  280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iotaTryNP_523695.1 Tryp_SPc 27..245 CDD:214473 66/247 (27%)
Tryp_SPc 28..247 CDD:238113 68/248 (27%)
CG3795NP_001284790.1 Tryp_SPc 60..281 CDD:238113 67/237 (28%)
Tryp_SPc 60..278 CDD:214473 65/233 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.