DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment iotaTry and Klk12

DIOPT Version :9

Sequence 1:NP_523695.1 Gene:iotaTry / 36223 FlyBaseID:FBgn0015001 Length:252 Species:Drosophila melanogaster
Sequence 2:XP_008757573.1 Gene:Klk12 / 308564 RGDID:1308975 Length:247 Species:Rattus norvegicus


Alignment Length:258 Identity:78/258 - (30%)
Similarity:112/258 - (43%) Gaps:44/258 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VLVLLLLGDASDVEATGRIIGGSDQLIRNAPWQVSIQISARHECGGVIYSKEIIITAGHC----- 69
            :|:||.:...|..:.. :|..|.:.:..:.||||.:.......||||:..::.::||.||     
  Rat     5 ILLLLCVVGLSQADRE-KIYNGVECVKNSQPWQVGLFHGKYLRCGGVLVDRKWVLTAAHCSGKYM 68

  Fly    70 --LHERSVT-------LMKVRVGAQNHNYGGTLVPVAAYKVHEQFDSRFLHYDIAVLRLSTPLTF 125
              |.|.|::       |........:.:|.|      ||:.||        :|:.:|||:.|::.
  Rat    69 VRLGEHSLSKLDLTEQLRLTTFSITHPSYHG------AYQNHE--------HDLRLLRLNRPISL 119

  Fly   126 GLSTRAINLASTSPSGGTTVTVTGWGHTDN--GALSDSLQKAQLQIIDRGECASQKFGYGADFVG 188
            ..:.|.:.|.|:....|....::|||.|:.  ....|.||...|.|:....|.       |.|.|
  Rat   120 TYAVRPVALPSSCAPTGAKCHISGWGTTNKPWDPFPDRLQCLDLSIVSNETCR-------AVFPG 177

  Fly   189 ---EETICA-ASTDADACTGDSGGPLVASSQLVGIVSWGY--RCADDNYPGVYADVAILRPWI 245
               |..:|| .....|||.||||||||....|.|:||||.  .|.....||||..|.....||
  Rat   178 RVTENMLCAGGEAGKDACQGDSGGPLVCGGVLQGLVSWGSVGPCGQKGIPGVYTKVCKYTDWI 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iotaTryNP_523695.1 Tryp_SPc 27..245 CDD:214473 72/239 (30%)
Tryp_SPc 28..247 CDD:238113 74/240 (31%)
Klk12XP_008757573.1 Tryp_SPc 21..240 CDD:214473 72/239 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 148 1.000 Domainoid score I4330
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.