DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment iotaTry and Klk14

DIOPT Version :9

Sequence 1:NP_523695.1 Gene:iotaTry / 36223 FlyBaseID:FBgn0015001 Length:252 Species:Drosophila melanogaster
Sequence 2:XP_038956840.1 Gene:Klk14 / 308562 RGDID:1308606 Length:310 Species:Rattus norvegicus


Alignment Length:252 Identity:81/252 - (32%)
Similarity:124/252 - (49%) Gaps:23/252 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IVATVLVLLLLGDASDVEATG--RIIGGSDQLIRNAPWQVSIQI--SARHECGGVIYSKEIIITA 66
            ::.|:|..|.:   :.|::.|  :|:||...:..:.||||::|.  ..|..||||:.|.:.:|||
  Rat    63 LLLTILQALAV---AIVQSQGDDKILGGYTCVQNSQPWQVALQAGPGRRFLCGGVLLSDQWVITA 124

  Fly    67 GHCLHERSVTLMKVRVGAQN-HNYGGT--LVPVAAYKVHEQFDSRFLHYDIAVLRLSTPLTFGLS 128
            .||..    .|:.|.:|..| ..:..|  ::.|.....|.|:..:....|:.:|:|...:..|.:
  Rat   125 AHCAR----PLLHVALGKHNLRRWEATQQVLRVVRQVPHPQYRPQAHDNDLMLLKLQRKVRLGRA 185

  Fly   129 TRAINLASTSPSGGTTVTVTGWGHTDNGAL--SDSLQKAQLQIIDRGECASQKFGYGADFVGEET 191
            .|.|.:|.:..|.||...|:|||.|.:..:  ..:||...:.|:....|.....|    .:....
  Rat   186 VRTIPVARSCASPGTPCRVSGWGTTASPIVRYPTALQCVNVNIMPEQVCHRAYPG----TITSGM 246

  Fly   192 ICAASTDA--DACTGDSGGPLVASSQLVGIVSWGY-RCADDNYPGVYADVAILRPWI 245
            :||...:.  |:|.||||||||...||.|:||||. |||...|||||.::.....||
  Rat   247 VCAGVPEGGKDSCQGDSGGPLVCQGQLQGLVSWGMERCAMPGYPGVYTNLCNYHSWI 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iotaTryNP_523695.1 Tryp_SPc 27..245 CDD:214473 74/227 (33%)
Tryp_SPc 28..247 CDD:238113 76/228 (33%)
Klk14XP_038956840.1 Tryp_SPc 84..306 CDD:238113 76/228 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 148 1.000 Domainoid score I4330
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 152 1.000 Inparanoid score I4263
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.