DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment iotaTry and Tpsg1

DIOPT Version :9

Sequence 1:NP_523695.1 Gene:iotaTry / 36223 FlyBaseID:FBgn0015001 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_783183.1 Gene:Tpsg1 / 302990 RGDID:631355 Length:311 Species:Rattus norvegicus


Alignment Length:269 Identity:80/269 - (29%)
Similarity:112/269 - (41%) Gaps:57/269 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LLLL-----GDASDVEATGRIIGGSDQLIRNAPWQVSIQISARHECGGVIYSKEIIITAGHC--- 69
            ||||     |......|..||:||........|||.|:::...|.|||.:.|.|.::||.||   
  Rat    10 LLLLAVPGCGQPQVSHAGSRIVGGHAAQAGAWPWQASLRLQKVHVCGGSLLSPEWVLTAAHCFSG 74

  Fly    70 --------LHERSVTLMKVRVGAQNHNYGGTLVPVAAYKVHEQFDSRFLHY-----------DIA 115
                    :|...:|:              ||.|      |.....:.:.|           |||
  Rat    75 SVNSSDYEVHLGELTI--------------TLSP------HFSTVKQIIMYSSAPGPPGSSGDIA 119

  Fly   116 VLRLSTPLTFGLSTRAINL--ASTSPSGGTTVTVTGWGHTDNGALSD---SLQKAQLQIIDRGEC 175
            :::|:||:......:.:.|  ||.....|....|||||:|..|....   :||:|::.::|...|
  Rat   120 LVQLATPVALSSQVQPVCLPEASADFHPGMQCWVTGWGYTQEGEPLKPPYNLQEAKVSVVDVETC 184

  Fly   176 ASQKFGYGADFVGEETICAASTDADACTGDSGGPLVASS----QLVGIVSWGYRCADDNYPGVYA 236
            :..........:..:.:||.. ..|||..|||||||...    |..|:||||..|...:.|||||
  Rat   185 SQAYSSSNGSLIQSDMLCAWG-PGDACQDDSGGPLVCRVAGIWQQAGVVSWGEGCGRPDRPGVYA 248

  Fly   237 DVAILRPWI 245
            .|.....||
  Rat   249 RVTAYVNWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iotaTryNP_523695.1 Tryp_SPc 27..245 CDD:214473 72/248 (29%)
Tryp_SPc 28..247 CDD:238113 73/249 (29%)
Tpsg1NP_783183.1 Tryp_SPc 29..257 CDD:214473 72/248 (29%)
Tryp_SPc 30..260 CDD:238113 73/249 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.