DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment iotaTry and Prss22

DIOPT Version :9

Sequence 1:NP_523695.1 Gene:iotaTry / 36223 FlyBaseID:FBgn0015001 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001100454.1 Gene:Prss22 / 302971 RGDID:1310880 Length:307 Species:Rattus norvegicus


Alignment Length:280 Identity:85/280 - (30%)
Similarity:128/280 - (45%) Gaps:40/280 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 TVLVLLLLGDASDVEAT--------------GRIIGGSDQLIRNAPWQVSIQISARHECGGVIYS 59
            |:::|:||...:.|.|.              .|::||.|......||.|||..:..|.|.|.:.:
  Rat    17 TLILLVLLTSTATVSAANIRGSPDCGKPQQLNRVVGGEDSADAQWPWIVSILKNGSHHCAGSLLT 81

  Fly    60 KEIIITAGHCLHER-------SVTLMKVRVGAQNHNYGGTLVPVAAYKVHEQFDSR-FLHYDIAV 116
            ...:::|.||....       ||.|...::|  |.......|.:|:...|.::..: ..|.|||:
  Rat    82 NRWVVSAAHCFSSNMDKPSPYSVLLGAWKLG--NPGPRSQKVGIASVLPHPRYSRKEGTHADIAL 144

  Fly   117 LRLSTPLTFGLSTRAINLASTS----PSGGTTVTVTGWGHTDNGA---LSDSLQKAQLQIIDRGE 174
            :||..|:.|......|.|..:|    |:  |...:.|||...:|.   ...:|||.::.|||...
  Rat   145 VRLERPIQFSERILPICLPDSSVHLPPN--TNCWIAGWGSIQDGVPLPRPQTLQKLKVPIIDPEL 207

  Fly   175 CASQKF-GYGADFVGEETICAASTDA--DACTGDSGGPLVASSQ----LVGIVSWGYRCADDNYP 232
            |.|..: |.|.:.:.|:.:||...:.  |||.|||||||:....    |.||:|||..||:.|.|
  Rat   208 CKSLYWRGAGQEAITEDMLCAGYLEGKRDACLGDSGGPLMCQVDDHWLLTGIISWGEGCAERNRP 272

  Fly   233 GVYADVAILRPWIVKAANAI 252
            |||..:...|||:.:....:
  Rat   273 GVYTSLLAHRPWVQRIVQGV 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iotaTryNP_523695.1 Tryp_SPc 27..245 CDD:214473 78/239 (33%)
Tryp_SPc 28..247 CDD:238113 78/240 (33%)
Prss22NP_001100454.1 Tryp_SPc 49..285 CDD:214473 78/239 (33%)
Tryp_SPc 50..288 CDD:238113 78/241 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.