DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment iotaTry and Elane

DIOPT Version :9

Sequence 1:NP_523695.1 Gene:iotaTry / 36223 FlyBaseID:FBgn0015001 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001100237.1 Gene:Elane / 299606 RGDID:1307968 Length:271 Species:Rattus norvegicus


Alignment Length:250 Identity:65/250 - (26%)
Similarity:106/250 - (42%) Gaps:28/250 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IVATVLVLLLLGDASDVEATGRIIGGSDQLIRNAPWQVSIQISARHECGGVIYSKEIIITAGHCL 70
            :.:.:|.|||:..|    ....|:||........|:.||:|....|.||..:.::..:::|.||:
  Rat    15 LASMLLALLLVCPA----LASEIVGGRPAQPHAWPFMVSLQRRGGHFCGATLIARNFVMSAAHCV 75

  Fly    71 HERSVTLMKVRVGAQN-HNYGGTLVPVAAYKVHEQ-FDSRFLHYDIAVLRLSTPLTFGLSTRAIN 133
            :.|:...::|.:||.: .....|....:..::.|. ||...|..||.:::|:...|...:.:...
  Rat    76 NGRNFQSVQVVLGAHDLRRREPTRQIFSVQRIFENGFDPSRLLNDIVIIQLNGSATINANVQVAE 140

  Fly   134 LASTSPSGG--TTVTVTGWGHT-DNGALSDSLQKAQLQIIDRGECASQKFGYGADFVGEETIC-- 193
            |.:.....|  |.....|||.. .|..|...||:..:.:: ...|..:           ..:|  
  Rat   141 LPAQGQGVGNRTPCVAMGWGRLGTNRPLPSVLQELNVTVV-TNLCRRR-----------VNVCTL 193

  Fly   194 AASTDADACTGDSGGPLVASSQLVGIVSW---GYRCADDNYPGVYADVAILRPWI 245
            .....|..|.||||||||.::.:.||.|:   |  |....||..:|.||....||
  Rat   194 VPRRQAGICFGDSGGPLVCNNLVQGIDSFIRGG--CGSGFYPDAFAPVAEFADWI 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iotaTryNP_523695.1 Tryp_SPc 27..245 CDD:214473 58/227 (26%)
Tryp_SPc 28..247 CDD:238113 59/227 (26%)
ElaneNP_001100237.1 Tryp_SPc 32..246 CDD:214473 58/227 (26%)
Tryp_SPc 33..249 CDD:238113 59/227 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.