DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment iotaTry and Klk10

DIOPT Version :9

Sequence 1:NP_523695.1 Gene:iotaTry / 36223 FlyBaseID:FBgn0015001 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001004100.1 Gene:Klk10 / 292850 RGDID:1303242 Length:279 Species:Rattus norvegicus


Alignment Length:254 Identity:75/254 - (29%)
Similarity:116/254 - (45%) Gaps:37/254 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LLLLGDAS--DVEATGRIIGGSDQLIRNAPWQVSIQISARHECGGVIYSKEIIITAGHCLHERSV 75
            |||.|:.:  |:||.|.:.....|     |||||:..:.:.:|.||:..:..::||.||...:. 
  Rat    35 LLLPGNTTREDLEAFGTLCPSVSQ-----PWQVSLFHNLQFQCAGVLVDQNWVLTAAHCWRNKP- 93

  Fly    76 TLMKVRVG------AQNHNYGGTLVPVAAYKVHEQFDS--------RFLHYDIAVLRLSTPLTFG 126
              ::.|||      .|:.....|..||    .|.::..        |...:|:.:|:||:|:...
  Rat    94 --LRARVGDDHLLLFQSEQLRSTNSPV----FHPKYQPCSGPVLPLRSDEHDLMMLKLSSPVVLT 152

  Fly   127 LSTRAINLASTSPSGGTTVTVTGWGHTDNGAL--SDSLQKAQLQIIDRGECASQKFGYGADFVGE 189
            .....:.|............|:|||.|.|..:  :.||..:::.::.:.:|  :.|..|.  :..
  Rat   153 SKVHPVQLPFQCAQPRQECQVSGWGTTANRRVKYNRSLSCSRVTLLSQKQC--ETFYPGV--ITN 213

  Fly   190 ETICAA-STDADACTGDSGGPLVASSQLVGIVSWG-YRC-ADDNYPGVYADVAILRPWI 245
            ..|||. ..|.|:|..|||||||..:.|.||:||. |.| |...||.|||.:.....||
  Rat   214 NMICAGMDRDQDSCQSDSGGPLVCDNTLHGILSWSIYPCGAATQYPAVYAKICNYTNWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iotaTryNP_523695.1 Tryp_SPc 27..245 CDD:214473 65/236 (28%)
Tryp_SPc 28..247 CDD:238113 67/237 (28%)
Klk10NP_001004100.1 Tryp_SPc 50..272 CDD:214473 66/237 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 148 1.000 Domainoid score I4330
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.