DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment iotaTry and Prss38

DIOPT Version :9

Sequence 1:NP_523695.1 Gene:iotaTry / 36223 FlyBaseID:FBgn0015001 Length:252 Species:Drosophila melanogaster
Sequence 2:XP_006246600.1 Gene:Prss38 / 287358 RGDID:1565729 Length:380 Species:Rattus norvegicus


Alignment Length:242 Identity:74/242 - (30%)
Similarity:111/242 - (45%) Gaps:33/242 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 GRIIGGSDQLIRNAPWQVSIQISARHECGGVIYSKEIIITAGHCL-HERSVTLMKVRVG------ 83
            |:::||...:.|..||||||..:..|.|||.|.:...::||.||. .|:.:....:.||      
  Rat   112 GKLLGGELTIDRKWPWQVSIHYAGFHVCGGSILNAYWVLTAAHCFAREKRLQTFDMYVGITNLEV 176

  Fly    84 AQNHNYGGTLVPVAAYKVHEQFDSRFLHYDIAVLRLSTPLTFG-------LSTRAINLASTSPSG 141
            |..|.....:..|..:...|.|..  :..|:|:::..:.:.|.       |.:..:||:..|   
  Rat   177 ANKHTQWFEINQVIIHPTFEMFHP--VGGDVALVQSKSAIVFSDYVLPICLPSSNLNLSDLS--- 236

  Fly   142 GTTVTVTGWGH-TDNGALSDSLQKAQLQIIDRGECASQKFGYG-ADFVGEETICAASTD--ADAC 202
               ...||||. :..|.....|.:|||.:|.:.:|   :..|| ..::..|.:||....  .:.|
  Rat   237 ---CWTTGWGMVSPQGETGKDLLEAQLPLIPKFQC---QLLYGLTSYLLPEMLCAGDIKNMKNVC 295

  Fly   203 TGDSGGPLVASSQ----LVGIVSWGYRCADDNYPGVYADVAILRPWI 245
            .||||.|||....    .:||||||..||...||||:|:|:....||
  Rat   296 EGDSGSPLVCKVNQTWLQIGIVSWGRGCAQPLYPGVFANVSYFLNWI 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iotaTryNP_523695.1 Tryp_SPc 27..245 CDD:214473 71/239 (30%)
Tryp_SPc 28..247 CDD:238113 73/240 (30%)
Prss38XP_006246600.1 Tryp_SPc 116..343 CDD:238113 73/238 (31%)
Tryp_SPc 116..342 CDD:214473 71/236 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.