DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment iotaTry and LOC286960

DIOPT Version :9

Sequence 1:NP_523695.1 Gene:iotaTry / 36223 FlyBaseID:FBgn0015001 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_775423.1 Gene:LOC286960 / 286960 RGDID:708585 Length:247 Species:Rattus norvegicus


Alignment Length:234 Identity:68/234 - (29%)
Similarity:107/234 - (45%) Gaps:15/234 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 ASDVEATGRIIGGSDQLIRNAPWQVSIQISARHECGGVIYSKEIIITAGHCLHERSVTLMKVRVG 83
            |..|....:|:||........|:|||:.....|:|||.:.|.:.:::|.||...:    ::||:|
  Rat    15 ALPVNDDDKIVGGYTCPKHLVPYQVSLHDGISHQCGGSLISDQWVLSAAHCYKRK----LQVRLG 75

  Fly    84 AQN-HNYGGTLVPVAAYKV--HEQFDSRFLHYDIAVLRLSTPLTFGLSTRAINLASTSPSGGTTV 145
            ..| |...|....:.|.|:  |.:::...|..||.:::|.:|.........::|..:..|.....
  Rat    76 EHNIHVLEGGEQFIDAEKIIRHPEYNKDTLDNDIMLIKLKSPAVLNSQVSTVSLPRSCASTDAQC 140

  Fly   146 TVTGWGHTDN--GALSDSLQKAQLQIIDRGECASQKFGYGADFVGEETICAASTDA--DACTGDS 206
            .|:|||:|.:  |.....||..:..::....|.....|.    :.....|....:.  |:|.|||
  Rat   141 LVSGWGNTVSIGGKYPALLQCLEAPVLSASSCKKSYPGQ----ITSNMFCLGFLEGGKDSCDGDS 201

  Fly   207 GGPLVASSQLVGIVSWGYRCADDNYPGVYADVAILRPWI 245
            |||:|.:.::.||||||..||....||||..|.....||
  Rat   202 GGPVVCNGEIQGIVSWGSVCAMRGKPGVYTKVCNYLSWI 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iotaTryNP_523695.1 Tryp_SPc 27..245 CDD:214473 64/224 (29%)
Tryp_SPc 28..247 CDD:238113 66/225 (29%)
LOC286960NP_775423.1 Tryp_SPc 23..240 CDD:214473 64/224 (29%)
Tryp_SPc 24..243 CDD:238113 66/225 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 152 1.000 Inparanoid score I4263
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.