DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment iotaTry and Tpsg1

DIOPT Version :9

Sequence 1:NP_523695.1 Gene:iotaTry / 36223 FlyBaseID:FBgn0015001 Length:252 Species:Drosophila melanogaster
Sequence 2:XP_006524421.1 Gene:Tpsg1 / 26945 MGIID:1349391 Length:368 Species:Mus musculus


Alignment Length:245 Identity:76/245 - (31%)
Similarity:108/245 - (44%) Gaps:42/245 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RIIGGSDQLIRNAPWQVSIQISARHECGGVIYSKEIIITAGHCL------HERSVTLMKVRVGAQ 85
            ||:||........|||.|:::...|.|||.:.|.|.::||.||.      .:..|.|.::.|   
Mouse    86 RIVGGHAAPAGTWPWQASLRLHKVHVCGGSLLSPEWVLTAAHCFSGSVNSSDYQVHLGELTV--- 147

  Fly    86 NHNYGGTLVPVAAYKVHEQFDSRFLHY-----------DIAVLRLSTPLTFGLSTRAINL--AST 137
                  ||.|      |.....|.:.|           |||:::||:|:......:.:.|  ||.
Mouse   148 ------TLSP------HFSTVKRIIMYTGSPGPPGSSGDIALVQLSSPVALSSQVQPVCLPEASA 200

  Fly   138 SPSGGTTVTVTGWGHTDNGALSD---SLQKAQLQIIDRGECASQKFGYGADFVGEETICAASTDA 199
            ....|....|||||:|..|....   :||:|::.::|...|:..........:..:.:||.. ..
Mouse   201 DFYPGMQCWVTGWGYTGEGEPLKPPYNLQEAKVSVVDVKTCSQAYNSPNGSLIQPDMLCARG-PG 264

  Fly   200 DACTGDSGGPLV----ASSQLVGIVSWGYRCADDNYPGVYADVAILRPWI 245
            |||..|||||||    .:.|..|:||||..|...:.|||||.|.....||
Mouse   265 DACQDDSGGPLVCQVAGTWQQAGVVSWGEGCGRPDRPGVYARVTAYVNWI 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iotaTryNP_523695.1 Tryp_SPc 27..245 CDD:214473 74/243 (30%)
Tryp_SPc 28..247 CDD:238113 75/244 (31%)
Tpsg1XP_006524421.1 Tryp_SPc 87..317 CDD:238113 75/244 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.