DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment iotaTry and TPSG1

DIOPT Version :9

Sequence 1:NP_523695.1 Gene:iotaTry / 36223 FlyBaseID:FBgn0015001 Length:252 Species:Drosophila melanogaster
Sequence 2:XP_011520748.1 Gene:TPSG1 / 25823 HGNCID:14134 Length:346 Species:Homo sapiens


Alignment Length:256 Identity:79/256 - (30%)
Similarity:109/256 - (42%) Gaps:56/256 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 EATGRIIGGSDQLIRNAPWQVSIQISARHECGGVIYSKEIIITAGHCLHERSVTLMKVRVGAQNH 87
            :|.|||:||........|||.|:::...|.|||.:.|.:.::||.||                  
Human    58 DAGGRIVGGHAAPAGAWPWQASLRLRRVHVCGGSLLSPQWVLTAAHC------------------ 104

  Fly    88 NYGGTLVPVAAYKVH---------EQFDS---RFLHY----------DIAVLRLSTPLTFGLSTR 130
             :.|:| ..:.|:||         ..|.:   ..||.          |||::.||.|:|  ||:|
Human   105 -FSGSL-NSSDYQVHLGELEITLSPHFSTVRQIILHSSPSGQPGTSGDIALVELSVPVT--LSSR 165

  Fly   131 AINL----ASTSPSGGTTVTVTGWGHTDNGALSD---SLQKAQLQIIDRGECASQKFGYGADFVG 188
            .:.:    ||.....|....|||||:|..|....   ||::.::.::|...|.....|.|...:.
Human   166 ILPVCLPEASDDFCPGIRCWVTGWGYTREGEPLPPPYSLREVKVSVVDTETCRRDYPGPGGSILQ 230

  Fly   189 EETICAASTDADACTGDSGGPLVASSQ----LVGIVSWGYRCADDNYPGVYADVAILRPWI 245
            .:.:||.. ..|||..|||||||....    ..|.||||..|...|.||||..|.....||
Human   231 PDMLCARG-PGDACQDDSGGPLVCQVNGAWVQAGTVSWGEGCGRPNRPGVYTRVPAYVNWI 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iotaTryNP_523695.1 Tryp_SPc 27..245 CDD:214473 75/250 (30%)
Tryp_SPc 28..247 CDD:238113 76/251 (30%)
TPSG1XP_011520748.1 Tryp_SPc 62..290 CDD:214473 75/250 (30%)
Tryp_SPc 63..293 CDD:238113 76/251 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.