DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment iotaTry and Try4

DIOPT Version :9

Sequence 1:NP_523695.1 Gene:iotaTry / 36223 FlyBaseID:FBgn0015001 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_035776.1 Gene:Try4 / 22074 MGIID:102757 Length:246 Species:Mus musculus


Alignment Length:255 Identity:87/255 - (34%)
Similarity:133/255 - (52%) Gaps:26/255 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VLVLLLLGD--ASDVEATGRIIGGSDQLIRNAPWQVSIQISARHECGGVIYSKEIIITAGHCLHE 72
            :|.|.|:|.  |..|:...:|:||......:.|:|||:. |..|.|||.:.:.:.:::|.||...
Mouse     4 LLFLALVGAAVAFPVDDDDKIVGGYTCRENSVPYQVSLN-SGYHFCGGSLINDQWVVSAAHCYKS 67

  Fly    73 RSVTLMKVRVGAQNHN-YGGTLVPVAAYKV--HEQFDSRFLHYDIAVLRLSTPLTFGLSTRAINL 134
            |    ::||:|..|.| ..|....|.:.|:  |..|:||.|:.||.:::|::|:|.......:.|
Mouse    68 R----IQVRLGEHNINVLEGNEQFVNSAKIIKHPNFNSRTLNNDIMLIKLASPVTLNARVATVAL 128

  Fly   135 ASTSPSGGTTVTVTGWGHTDNGALS--DSLQKAQLQIIDRGECASQKFGYGADFVGEET---ICA 194
            .|:....||...::|||:|.:..::  |.||.....::.:.:|.       |.:.|:.|   ||.
Mouse   129 PSSCAPAGTQCLISGWGNTLSFGVNNPDLLQCLDAPLLPQADCE-------ASYPGKITNNMICV 186

  Fly   195 ASTDA--DACTGDSGGPLVASSQLVGIVSWGYRCADDNYPGVYADVAILRPWIVK--AAN 250
            ...:.  |:|.||||||:|.:.||.|||||||.||..:.||||..|.....||..  |||
Mouse   187 GFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCALKDNPGVYTKVCNYVDWIQNTIAAN 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iotaTryNP_523695.1 Tryp_SPc 27..245 CDD:214473 76/227 (33%)
Tryp_SPc 28..247 CDD:238113 78/228 (34%)
Try4NP_035776.1 Tryp_SPc 23..239 CDD:214473 76/227 (33%)
Tryp_SPc 24..242 CDD:238113 78/229 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.