DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment iotaTry and Prss38

DIOPT Version :9

Sequence 1:NP_523695.1 Gene:iotaTry / 36223 FlyBaseID:FBgn0015001 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001038986.1 Gene:Prss38 / 216797 MGIID:2685095 Length:322 Species:Mus musculus


Alignment Length:239 Identity:75/239 - (31%)
Similarity:112/239 - (46%) Gaps:27/239 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 GRIIGGSDQLIRNAPWQVSIQISARHECGGVIYSKEIIITAGHCLHE-RSVTLMKVRVG------ 83
            |:::||.....|..|||||:..|..|.|||.|.|...:::|.||... :.:....:.||      
Mouse    54 GKLLGGEFARDRKWPWQVSLHYSGFHICGGSILSAYWVLSAAHCFDRGKKLETYDIYVGITNLEK 118

  Fly    84 AQNHNYGGTLVPVAAYKVHEQFDSRFLHYDIAVLRLSTPLTFGLSTRAINLASTSPSG----GTT 144
            |..|.....:..|..:...:.:..  :..|:|:::|.:.:.|......|.|   .||.    ..:
Mouse   119 ANRHTQWFEIYQVIIHPTFQMYHP--IGGDVALVQLKSAIVFSDFVLPICL---PPSDLYLINLS 178

  Fly   145 VTVTGWGH-TDNGALSDSLQKAQLQIIDRGECASQKFGYG-ADFVGEETICAA--STDADACTGD 205
            ...||||. :..|...:.|.:|||.:|.|.:|   :..|| :.::..|.:|||  .|..:.|.||
Mouse   179 CWTTGWGMISPQGETGNELLEAQLPLIPRFQC---QLLYGLSSYLLPEMLCAADIKTMKNVCEGD 240

  Fly   206 SGGPLVASSQ----LVGIVSWGYRCADDNYPGVYADVAILRPWI 245
            ||.|||....    .:||||||..||...||||:|:|:....||
Mouse   241 SGSPLVCKQNQTWLQIGIVSWGRGCAQPLYPGVFANVSYFLSWI 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iotaTryNP_523695.1 Tryp_SPc 27..245 CDD:214473 72/236 (31%)
Tryp_SPc 28..247 CDD:238113 74/237 (31%)
Prss38NP_001038986.1 Tryp_SPc 58..287 CDD:238113 74/235 (31%)
Tryp_SPc 58..284 CDD:214473 72/233 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.